SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479145594|ref|YP_007776457.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479145594|ref|YP_007776457.1|
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily FlgN-like 0.000000000432
Family FlgN-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479145594|ref|YP_007776457.1|
Sequence length 159
Comment FlgN protein [Eubacterium siraeum 70/3]
Sequence
MTIETADRIIGFLEKYNGVYRDMVAFLTEKQAKVMADDLLWLLDSVEDEQALVMKIQSEE
SARSALFEELGLGEIKAKQLIEAVPDERKSKLTLLYDELTGYVARIKQLNNIIVETVEKK
LSVQEELMRKTGMTLTETYNGYGAKIKHTSAPKGFLGNI
Download sequence
Identical sequences D4JWT6
gi|479145594|ref|YP_007776457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]