SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108810836|ref|YP_646603.1| from Yersinia pestis Nepal516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108810836|ref|YP_646603.1|
Domain Number 1 Region: 2-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-57
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000759
Further Details:      
 
Domain Number 2 Region: 343-466
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.84e-39
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108810836|ref|YP_646603.1|
Sequence length 474
Comment dihydrolipoamide dehydrogenase [Yersinia pestis Nepal516]
Sequence
MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGVCLNVGCIPSKALLHVA
KVIEEAKALAEHGIVFGEPKTDIDKVRVWKDKVINQLTGGLAGMAKGRKVKVVTGFGKFT
GANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHEDSRIWDSTDALALRTVPERLLV
MGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVTA
VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIHVDKQ
LRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWV
GLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKLIFDKETHRIIGGAIVGTNGGE
LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK
Download sequence
Identical sequences A0A0E1NVX6 A0A0E8XF12 A0A0H2YG72 A0A0H3B5I2 A0A0M1VB18 A0A0U1ERU8 A0A0U1QXQ5 A0A154RM25
gi|170025704|ref|YP_001722209.1| gi|108810836|ref|YP_646603.1| gi|108808910|ref|YP_652826.1| 349747.YpsIP31758_3360 360102.YPA_2919 377628.YPN_0671 386656.YPDSF_2938 502800.YPK_3489 502801.YPTS_0745 gi|384127452|ref|YP_005510066.1| gi|145600197|ref|YP_001164273.1| gi|153948484|ref|YP_001402317.1| gi|186894074|ref|YP_001871186.1| gi|384138732|ref|YP_005521434.1| WP_002209332.1.66118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]