SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108812767|ref|YP_648534.1| from Yersinia pestis Nepal516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108812767|ref|YP_648534.1|
Domain Number 1 Region: 1-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108812767|ref|YP_648534.1|
Sequence length 320
Comment thioredoxin reductase [Yersinia pestis Nepal516]
Sequence
MSTAKHSKLIILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPEGL
TGPALMERMHEHAEKFQTEIIFDHISSVDLQNRPFRLFGDGAEYTCDALIIATGASARYL
GMASEEAFKGKGVSACATCDGFFYRNQKVAVVGGGNTAVEEALYLANIAAEVHLIHRRDT
FRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTHSDETEELAVAGVF
IAIGHSPNTGIFSDQLALENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAG
TGCMAALDAERYLDGLANDK
Download sequence
Identical sequences A0A0E1NR38 A0A0H2YKP5 A0A0H3B3L8 A0A0M1V4V2 A0A0U1EPT3 A0A0U1R3A3 A0A208RS71 A0A2A7VDY5 Q0WH41 Q66CK4 Q7CHI6
gi|51595739|ref|YP_069930.1| IDP02353 gi|108812767|ref|YP_648534.1| gi|384415266|ref|YP_005624628.1| gi|384125395|ref|YP_005508009.1| gi|294503364|ref|YP_003567426.1| gi|108806661|ref|YP_650577.1| gi|153950849|ref|YP_001401563.1| gi|384121808|ref|YP_005504428.1| gi|384140731|ref|YP_005523433.1| gi|218928522|ref|YP_002346397.1| gi|170024912|ref|YP_001721417.1| gi|145599593|ref|YP_001163669.1| gi|162418769|ref|YP_001606115.1| WP_002211341.1.100083 WP_002211341.1.100246 WP_002211341.1.100593 WP_002211341.1.10066 WP_002211341.1.100921 WP_002211341.1.100931 WP_002211341.1.10105 WP_002211341.1.101305 WP_002211341.1.101928 WP_002211341.1.102012 WP_002211341.1.102067 WP_002211341.1.10736 WP_002211341.1.10935 WP_002211341.1.10955 WP_002211341.1.11693 WP_002211341.1.12167 WP_002211341.1.12463 WP_002211341.1.12736 WP_002211341.1.12857 WP_002211341.1.1388 WP_002211341.1.14063 WP_002211341.1.14169 WP_002211341.1.14804 WP_002211341.1.15321 WP_002211341.1.15555 WP_002211341.1.15605 WP_002211341.1.16243 WP_002211341.1.16333 WP_002211341.1.17135 WP_002211341.1.17141 WP_002211341.1.17608 WP_002211341.1.17873 WP_002211341.1.17983 WP_002211341.1.18208 WP_002211341.1.18640 WP_002211341.1.18826 WP_002211341.1.19329 WP_002211341.1.19425 WP_002211341.1.19739 WP_002211341.1.20035 WP_002211341.1.20380 WP_002211341.1.20547 WP_002211341.1.2064 WP_002211341.1.20932 WP_002211341.1.21486 WP_002211341.1.21784 WP_002211341.1.21879 WP_002211341.1.21934 WP_002211341.1.22530 WP_002211341.1.22542 WP_002211341.1.22708 WP_002211341.1.23157 WP_002211341.1.23271 WP_002211341.1.23687 WP_002211341.1.23811 WP_002211341.1.24002 WP_002211341.1.2451 WP_002211341.1.24517 WP_002211341.1.25181 WP_002211341.1.25394 WP_002211341.1.26383 WP_002211341.1.2640 WP_002211341.1.26960 WP_002211341.1.27124 WP_002211341.1.27251 WP_002211341.1.2726 WP_002211341.1.28647 WP_002211341.1.28922 WP_002211341.1.29157 WP_002211341.1.29186 WP_002211341.1.29355 WP_002211341.1.2947 WP_002211341.1.29622 WP_002211341.1.29685 WP_002211341.1.29814 WP_002211341.1.3092 WP_002211341.1.30931 WP_002211341.1.311 WP_002211341.1.31336 WP_002211341.1.31496 WP_002211341.1.31721 WP_002211341.1.31739 WP_002211341.1.31805 WP_002211341.1.32343 WP_002211341.1.32388 WP_002211341.1.32446 WP_002211341.1.32736 WP_002211341.1.33203 WP_002211341.1.33324 WP_002211341.1.33661 WP_002211341.1.33775 WP_002211341.1.33937 WP_002211341.1.34031 WP_002211341.1.34138 WP_002211341.1.35389 WP_002211341.1.35538 WP_002211341.1.36088 WP_002211341.1.37494 WP_002211341.1.37863 WP_002211341.1.38147 WP_002211341.1.38235 WP_002211341.1.38743 WP_002211341.1.38824 WP_002211341.1.38993 WP_002211341.1.39066 WP_002211341.1.39346 WP_002211341.1.3976 WP_002211341.1.39858 WP_002211341.1.40071 WP_002211341.1.40134 WP_002211341.1.40534 WP_002211341.1.40853 WP_002211341.1.41984 WP_002211341.1.4210 WP_002211341.1.42361 WP_002211341.1.42490 WP_002211341.1.42976 WP_002211341.1.44408 WP_002211341.1.44598 WP_002211341.1.44603 WP_002211341.1.44832 WP_002211341.1.45214 WP_002211341.1.46262 WP_002211341.1.46545 WP_002211341.1.46686 WP_002211341.1.46697 WP_002211341.1.46731 WP_002211341.1.4678 WP_002211341.1.46891 WP_002211341.1.47387 WP_002211341.1.47440 WP_002211341.1.47769 WP_002211341.1.47881 WP_002211341.1.48166 WP_002211341.1.48722 WP_002211341.1.4889 WP_002211341.1.49315 WP_002211341.1.49906 WP_002211341.1.4997 WP_002211341.1.50010 WP_002211341.1.50093 WP_002211341.1.50106 WP_002211341.1.50185 WP_002211341.1.50984 WP_002211341.1.51284 WP_002211341.1.51293 WP_002211341.1.51588 WP_002211341.1.51934 WP_002211341.1.52158 WP_002211341.1.52473 WP_002211341.1.52734 WP_002211341.1.52792 WP_002211341.1.52819 WP_002211341.1.52969 WP_002211341.1.53147 WP_002211341.1.53300 WP_002211341.1.53838 WP_002211341.1.53848 WP_002211341.1.53883 WP_002211341.1.53953 WP_002211341.1.54568 WP_002211341.1.54951 WP_002211341.1.55194 WP_002211341.1.55695 WP_002211341.1.5592 WP_002211341.1.56031 WP_002211341.1.56912 WP_002211341.1.56953 WP_002211341.1.57585 WP_002211341.1.57657 WP_002211341.1.58067 WP_002211341.1.58543 WP_002211341.1.59102 WP_002211341.1.59431 WP_002211341.1.5957 WP_002211341.1.59635 WP_002211341.1.5968 WP_002211341.1.59687 WP_002211341.1.59789 WP_002211341.1.59885 WP_002211341.1.60437 WP_002211341.1.60707 WP_002211341.1.60896 WP_002211341.1.61689 WP_002211341.1.62232 WP_002211341.1.62342 WP_002211341.1.6270 WP_002211341.1.6333 WP_002211341.1.63387 WP_002211341.1.63641 WP_002211341.1.64142 WP_002211341.1.64474 WP_002211341.1.64780 WP_002211341.1.64786 WP_002211341.1.64910 WP_002211341.1.653 WP_002211341.1.65400 WP_002211341.1.65554 WP_002211341.1.6570 WP_002211341.1.65706 WP_002211341.1.65718 WP_002211341.1.6581 WP_002211341.1.66118 WP_002211341.1.66546 WP_002211341.1.66616 WP_002211341.1.67404 WP_002211341.1.67850 WP_002211341.1.6791 WP_002211341.1.68361 WP_002211341.1.68753 WP_002211341.1.68855 WP_002211341.1.69018 WP_002211341.1.69316 WP_002211341.1.69951 WP_002211341.1.70117 WP_002211341.1.70171 WP_002211341.1.70319 WP_002211341.1.70377 WP_002211341.1.70417 WP_002211341.1.70726 WP_002211341.1.7083 WP_002211341.1.7169 WP_002211341.1.71744 WP_002211341.1.72280 WP_002211341.1.72440 WP_002211341.1.72486 WP_002211341.1.7402 WP_002211341.1.74131 WP_002211341.1.74577 WP_002211341.1.74738 WP_002211341.1.75169 WP_002211341.1.75173 WP_002211341.1.7518 WP_002211341.1.75208 WP_002211341.1.75337 WP_002211341.1.75407 WP_002211341.1.75636 WP_002211341.1.76670 WP_002211341.1.77295 WP_002211341.1.77387 WP_002211341.1.77429 WP_002211341.1.77569 WP_002211341.1.78004 WP_002211341.1.7841 WP_002211341.1.78556 WP_002211341.1.79515 WP_002211341.1.79609 WP_002211341.1.79825 WP_002211341.1.79981 WP_002211341.1.8009 WP_002211341.1.80331 WP_002211341.1.81848 WP_002211341.1.81877 WP_002211341.1.8210 WP_002211341.1.82133 WP_002211341.1.82151 WP_002211341.1.82270 WP_002211341.1.82619 WP_002211341.1.8303 WP_002211341.1.83039 WP_002211341.1.83265 WP_002211341.1.8420 WP_002211341.1.84703 WP_002211341.1.84720 WP_002211341.1.85269 WP_002211341.1.8559 WP_002211341.1.85802 WP_002211341.1.86034 WP_002211341.1.86059 WP_002211341.1.86413 WP_002211341.1.87107 WP_002211341.1.8728 WP_002211341.1.87418 WP_002211341.1.8762 WP_002211341.1.87853 WP_002211341.1.87988 WP_002211341.1.88362 WP_002211341.1.88472 WP_002211341.1.89359 WP_002211341.1.89542 WP_002211341.1.8964 WP_002211341.1.9051 WP_002211341.1.90624 WP_002211341.1.91263 WP_002211341.1.91373 WP_002211341.1.91844 WP_002211341.1.92030 WP_002211341.1.92331 WP_002211341.1.92604 WP_002211341.1.927 WP_002211341.1.9311 WP_002211341.1.9320 WP_002211341.1.93623 WP_002211341.1.93928 WP_002211341.1.93933 WP_002211341.1.94052 WP_002211341.1.94201 WP_002211341.1.94545 WP_002211341.1.94683 WP_002211341.1.95746 WP_002211341.1.95981 WP_002211341.1.97245 WP_002211341.1.97448 WP_002211341.1.97791 WP_002211341.1.97864 WP_002211341.1.97894 WP_002211341.1.99109 WP_002211341.1.9941 WP_002211341.1.99416 WP_002211341.1.99882 WP_002211341.1.99972 WP_002211341.1.99990 YP_002346397.1.25044 gi|45441046|ref|NP_992585.1| gi|186894816|ref|YP_001871928.1| 187410.y2802 214092.YPO1374 229193.YP_1219 273123.YPTB1399 349746.YpAngola_A1611 349747.YpsIP31758_2598 360102.YPA_0664 377628.YPN_2606 386656.YPDSF_2321 502800.YPK_2687 502801.YPTS_1499 gi|22126679|ref|NP_670102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]