SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108813786|ref|YP_649553.1| from Yersinia pestis Nepal516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108813786|ref|YP_649553.1|
Domain Number 1 Region: 5-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.76e-60
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000677
Further Details:      
 
Domain Number 2 Region: 341-455
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.15e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108813786|ref|YP_649553.1|
Sequence length 455
Comment glutathione reductase [Yersinia pestis Nepal516]
Sequence
METTLMTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNVGCVPKKVMWH
AAQIAEAIHLYGPDYGFDTTVNHFDWKKLIANRTAYIDRIHQSYERGLGNNKVDVIQGFA
RFVDAHTVEVNGETITADHILIATGGRPSHPDIPGAEYGIDSDGFFELDEMPKRVAVVGA
GYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTESVPKAVI
KNADGSLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTNDKGYIEVDKFQNTNV
KGIYAVGDNTGVVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLT
EPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCRMKLVCVGAEEKIVGIHGIGFGMDEI
LQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR
Download sequence
Identical sequences A0A0H2YCE4 A0A0H2YM23
gi|108809796|ref|YP_653712.1| 360102.YPA_3805 377628.YPN_3626 386656.YPDSF_3342 gi|145600594|ref|YP_001164670.1| gi|108813786|ref|YP_649553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]