SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycgr1|64178|e_gw.11.442.1 from Mycosphaerella graminicola IPO323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycgr1|64178|e_gw.11.442.1
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000291
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 70-113
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000288
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycgr1|64178|e_gw.11.442.1
Sequence length 942
Sequence
MVFCTYCGQSFTRDEHLERHILTHTNVKPFKCFTCHMSFARRDLLQRHYTVHGRDQNQNE
IPAVNGMIPKSAGRTPIACSNCAKTKTKCDKKFPCSRCAGRNLRCTLRPTRRASKNANRV
GATLESATDVPTEVTTVNVEATSKDTRAQENSSSPSSQKSGTPIKSFMDHNLMSGFPGLT
NPSKDSSDDGSSPRFLLDWSQMQMPLGYDNMIQSDLMLDPELSFDPNSVPLAPHADGILS
IMPELANGGMESLITPFETPKMSRSFVELGLGNSNPAFHSHRHQSMPSVQSIPNSGNEMP
AMIAAQDGWSAFRCTPTLPSSSCPKTAKLNLEQLEETLRNHEGWVSWSPRWEDNDLAGGG
DHLTVMQLHESTRDKLLAIMQSFLHKALETHREGRGTSNGSHSPNPSGASNFVLLPPGRV
LEYFLRSYSNSFERYFPLTSRSTLDANELMHCYNDRAASILVLLMIAQGAANIPSPEARM
LTGGLTEACRISLFDLIERNIIMSGDPIVLHSALLFTVQAAWSGDKWQMDIAMGQRGMYF
AMLRHSGVLDRSSHAASAQPQRTLEQLWTDWIQNESRSRLIYSWVMVDQDLALFHDTAPL
FSVTEFGAPMPDADRLWHAKSAEQWSSTFERVHEFSSGFSSVGSGARPLSLRDLFRHFLD
DDLIPMGIEMTPLQLRLLLHPLQSMVCQFSQLLSCFAPATYRTSISVHPNQAQPSSRNIS
QSSTRTRLAEVQALLQRWFDLAERYLKANPLCALMQTNLILFHLISLNAVTNFPEIERLA
RRENVDGTYHQLLWLHKRCIPDVEEAVFHCGQIFRLVRSMPRGVRPPWWAGAIYRVALIL
WTDSLTHKDALTSTSPQGNGMFPSPIAGPSFAIDALPPDHALIVRYLTKREGVPCVTKLD
GSQMGLERAYPVLRHCVEVIDEGCSTRFSDAIRGKLERLSRG
Download sequence
Identical sequences jgi|Mycgr1|64178|e_gw.11.442.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]