SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycgr1|69125|estExt_fgenesh2_pm.C_90099 from Mycosphaerella graminicola IPO323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycgr1|69125|estExt_fgenesh2_pm.C_90099
Domain Number 1 Region: 15-109,174-407
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.28e-67
Family IF2B-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycgr1|69125|estExt_fgenesh2_pm.C_90099
Sequence length 414
Sequence
MPSSVATQAPSLTTFLKSHKSSDIESSIELLISLLKRRQIRNSRPCAIATAQLLLRVVGE
QRWKDAETLIQRVRQVGRRLTAAQPREMAVGNIVRRILGIVREITEDNPNEDHDEDGSFG
HTQRPSMPAPAGSLFGIFQQPGAFSSNAGSPLTSGTASPIPHKQAEVKVEKIDIKAEVID
GIKDLLEELDIVDTQIAESALDHIHSNEIILTHTSSQTVQKFLAAAARKRSFTVVHAEAY
PNDHLSTHATIVNGSTASAEDDSMDRWKPLTSLGIKVILIPDTAVFALMSRINKVILAPH
TVLANGSLIAAAGASAIAQAAQMHRVPVVVLSGVYKLSPVYPFDSNELLEYGDPSKVVGF
DEGGLVGGVDVVNPVFDHVGADLVDLYVTNLGGCAPSFLYRIVADHYRGEDVDL
Download sequence
Identical sequences jgi|Mycgr1|69125|estExt_fgenesh2_pm.C_90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]