SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycgr1|71900|estExt_gwp_gw1.C_13439 from Mycosphaerella graminicola IPO323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycgr1|71900|estExt_gwp_gw1.C_13439
Domain Number 1 Region: 6-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000193
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 64-107
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000824
Family Zn2/Cys6 DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycgr1|71900|estExt_gwp_gw1.C_13439
Sequence length 816
Sequence
MSSLGVFKCTQCDKVYKTRTSLTRHAHNHSRGPPQHQCDTCGVLFARRDILNRHVSNGHC
ANSNAARHRCHTACEACRGARIKCDGQVPCRACFEGRRECKYPTTTGRISHASRAPRSVK
AEGSGEVDEKSVGSPYADASDEGMHGSEDRESPEESVHGPRANERTHSQALMTPTSLSPA
IGSVAPYKEMLTAGAADSHNLRLAGDVHEEKAWPWLHENLFLLNGGKSQSRKPSLHHQNA
RPTSTAQDAKGSSISSPTSNNTHSPLSNTIENLVAYAANTAFSPDDRGIRRRYWESVSLQ
LADIFQDASKKSVVDPHRTLYQLAESFLTNFNSGWPILNHEQLDPDTHHPVLFLVVGAIG
AMFGDALHRQYGTLMHERLRRLLSASLYDLEGPDEDLVWLAQARLLTQTAALYFGQHQGF
SYAQHIAAITVAQLRRMGFFREPSPDGLLMAKLAKMSNEAELAHYKQAETRRRIAFGILR
TDVYTSVLLSTRPLLSADEMKLTFPRSDSLWMNLEGLSPEAQLQAHQIENARCLQMPFSD
LIRIFLDKAEPNPELGALGYELTMFGLQDAVWKFTQDPELFPRLTGHCLEEIDIAVSEHR
ESVPRPNGERIIPALAVGQIRRRMDELYAERARLLHALDSWSHAVNIAINNGTFMYHRGT
LLSCLMLYHLSRLRLTAPLEWLHHISYRAAEPQTVDWHTHRKVEGWLRSAFAPQAAQQAW
DVKWLIESELQRPKGDRAHFNFLAFCSLHHAAVVLWTVAGSGEMRPSTIPKAEIETFLTN
CPSLFSQLSSLGGNSFEVAAYRLAGHRFPTVAEVGN
Download sequence
Identical sequences F9WYN7
XP_003855903.1.87952 jgi|Mycgr1|71900|estExt_gwp_gw1.C_13439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]