SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycgr1|90753|estExt_Genewise.C_21058 from Mycosphaerella graminicola IPO323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycgr1|90753|estExt_Genewise.C_21058
Domain Number 1 Region: 150-487
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.02e-81
Family IF2B-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycgr1|90753|estExt_Genewise.C_21058
Sequence length 494
Sequence
MSEQQKPEQKPAAAATPAAAAASTSTEEKISPAEAKKRAKAEKQARRAAEKEEKGLPAVT
APLPSAPSAANGEVKGGQQKKAGTPKQNDTGKKPSGAQAGSLPVRARRASQPASSATPPK
LAVKKAENKQVELFSHLYTQPRRQNLENVPKDVHPAVLALGLQISSYEICGSSARCVAML
QAFKDAIQTYTTPVGTSLARHLTSHYLSPQIDFLKSCRPISESMGNAIRWLKKLIVEIDP
ATPEQEAKDYLSESIDKFIQERITVTDQAIAASASSLIKSGSVVLTYAKSAIVEKTILQA
HADGTSFRVLVVDSRPLYEGKNLAHTLMNAGVQVEYLPFSGIAHAVKDATLVLLGAHSML
SNGRLMSRVGTASVAIAAHKADVPVIVCCESVKFSGKVALDSIVLNEVAPAEELLLAPSL
APTPATEPGKKDDTDGEEKTRKTLHDWKDIPNLRILNLMYDVTPAECLRMVICEYGNVPP
SSVPVVHRLANEGM
Download sequence
Identical sequences F9X2W2
jgi|Mycgr1|90753|estExt_Genewise.C_21058 XP_003855556.1.87952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]