SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218927786|ref|YP_002345661.1| from Yersinia pestis CO92

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218927786|ref|YP_002345661.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.55e-112
Family FMN-linked oxidoreductases 0.000000000359
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.71e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000287
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.62e-22
Family C-terminal domain of adrenodoxin reductase-like 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218927786|ref|YP_002345661.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Yersinia pestis CO92]
Sequence
MLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFYAERAAGGVGLIVTGG
IAPNMKGGVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQILHAGRYSYQKHPVAPSA
LQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIMGSEGYLINQFLTARTNQ
RDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDLVEEGSNWVEIEQLAQAVE
QAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVNIPLITTNRINDPAVAEQV
LADGCADMVSMARPFLADAAFVQKAAQGRADEINTCIGCNQACLDQIFDGKLTSCLVNPR
ACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGHQVTLFDAAAEIGGQFNIAKQI
PGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEFDEVILACGIQPRLPCINGIDHP
KVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQSGDSPRFDSTAFSTEWGIDQDLA
HRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKTTGWIHRTSLAMRGVKMLNSVSYEA
IDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELHQPLLDMGKTVYLIGGADKAVELDAR
RAIDQGTRLALAI
Download sequence
Identical sequences A0A0E1NT43 A0A0H2YFN3 A0A0H3AXM2 A0A0M1V8S8 A0A208SCC9 Q0WJ77
gi|294502675|ref|YP_003566737.1| gi|384121109|ref|YP_005503729.1| gi|218927786|ref|YP_002345661.1| gi|384137422|ref|YP_005520124.1| gi|108809190|ref|YP_653106.1| gi|108810623|ref|YP_646390.1| gi|145597688|ref|YP_001161764.1| gi|384124988|ref|YP_005507602.1| IDP00551 214092.YPO0589 349746.YpAngola_A1093 360102.YPA_3199 377628.YPN_0458 386656.YPDSF_0376 502800.YPK_0563 WP_002210401.1.100083 WP_002210401.1.100246 WP_002210401.1.100921 WP_002210401.1.100931 WP_002210401.1.10105 WP_002210401.1.101305 WP_002210401.1.101382 WP_002210401.1.101928 WP_002210401.1.102012 WP_002210401.1.102067 WP_002210401.1.10736 WP_002210401.1.10935 WP_002210401.1.10955 WP_002210401.1.11693 WP_002210401.1.12463 WP_002210401.1.12736 WP_002210401.1.12857 WP_002210401.1.1388 WP_002210401.1.14063 WP_002210401.1.14804 WP_002210401.1.15321 WP_002210401.1.15555 WP_002210401.1.15605 WP_002210401.1.15689 WP_002210401.1.16243 WP_002210401.1.16333 WP_002210401.1.17135 WP_002210401.1.17608 WP_002210401.1.17873 WP_002210401.1.17983 WP_002210401.1.18640 WP_002210401.1.18826 WP_002210401.1.19329 WP_002210401.1.19425 WP_002210401.1.19739 WP_002210401.1.19763 WP_002210401.1.2064 WP_002210401.1.21486 WP_002210401.1.21784 WP_002210401.1.21879 WP_002210401.1.21934 WP_002210401.1.22530 WP_002210401.1.22542 WP_002210401.1.22708 WP_002210401.1.23157 WP_002210401.1.23271 WP_002210401.1.23687 WP_002210401.1.23811 WP_002210401.1.24002 WP_002210401.1.2451 WP_002210401.1.25181 WP_002210401.1.25394 WP_002210401.1.2640 WP_002210401.1.26776 WP_002210401.1.26960 WP_002210401.1.27124 WP_002210401.1.27251 WP_002210401.1.28647 WP_002210401.1.28922 WP_002210401.1.29157 WP_002210401.1.29355 WP_002210401.1.2947 WP_002210401.1.29622 WP_002210401.1.2964 WP_002210401.1.29685 WP_002210401.1.29814 WP_002210401.1.3092 WP_002210401.1.30931 WP_002210401.1.311 WP_002210401.1.31336 WP_002210401.1.31496 WP_002210401.1.31739 WP_002210401.1.31805 WP_002210401.1.32343 WP_002210401.1.32388 WP_002210401.1.32446 WP_002210401.1.33203 WP_002210401.1.33937 WP_002210401.1.34031 WP_002210401.1.34138 WP_002210401.1.35389 WP_002210401.1.35538 WP_002210401.1.36088 WP_002210401.1.37174 WP_002210401.1.37494 WP_002210401.1.37863 WP_002210401.1.38147 WP_002210401.1.38235 WP_002210401.1.38743 WP_002210401.1.38824 WP_002210401.1.38993 WP_002210401.1.39066 WP_002210401.1.39346 WP_002210401.1.3976 WP_002210401.1.40071 WP_002210401.1.40134 WP_002210401.1.40534 WP_002210401.1.40853 WP_002210401.1.41196 WP_002210401.1.4210 WP_002210401.1.42490 WP_002210401.1.44408 WP_002210401.1.44598 WP_002210401.1.44603 WP_002210401.1.44832 WP_002210401.1.45198 WP_002210401.1.45214 WP_002210401.1.46262 WP_002210401.1.46686 WP_002210401.1.46731 WP_002210401.1.4678 WP_002210401.1.46891 WP_002210401.1.47387 WP_002210401.1.47440 WP_002210401.1.48166 WP_002210401.1.48722 WP_002210401.1.4889 WP_002210401.1.49906 WP_002210401.1.4997 WP_002210401.1.50010 WP_002210401.1.50093 WP_002210401.1.50106 WP_002210401.1.50984 WP_002210401.1.51284 WP_002210401.1.51293 WP_002210401.1.51588 WP_002210401.1.51772 WP_002210401.1.51934 WP_002210401.1.52158 WP_002210401.1.52247 WP_002210401.1.52734 WP_002210401.1.52792 WP_002210401.1.52819 WP_002210401.1.52969 WP_002210401.1.53300 WP_002210401.1.53838 WP_002210401.1.53953 WP_002210401.1.54568 WP_002210401.1.54951 WP_002210401.1.55194 WP_002210401.1.5592 WP_002210401.1.56031 WP_002210401.1.56912 WP_002210401.1.56953 WP_002210401.1.57585 WP_002210401.1.57657 WP_002210401.1.58067 WP_002210401.1.58794 WP_002210401.1.59102 WP_002210401.1.59431 WP_002210401.1.5957 WP_002210401.1.59635 WP_002210401.1.59687 WP_002210401.1.59885 WP_002210401.1.60437 WP_002210401.1.60707 WP_002210401.1.60896 WP_002210401.1.61689 WP_002210401.1.62232 WP_002210401.1.62342 WP_002210401.1.6270 WP_002210401.1.63387 WP_002210401.1.64142 WP_002210401.1.64474 WP_002210401.1.64780 WP_002210401.1.64786 WP_002210401.1.64910 WP_002210401.1.653 WP_002210401.1.65400 WP_002210401.1.65554 WP_002210401.1.6570 WP_002210401.1.65706 WP_002210401.1.65718 WP_002210401.1.6581 WP_002210401.1.66546 WP_002210401.1.66616 WP_002210401.1.67404 WP_002210401.1.67850 WP_002210401.1.68361 WP_002210401.1.68753 WP_002210401.1.68855 WP_002210401.1.69018 WP_002210401.1.69316 WP_002210401.1.69951 WP_002210401.1.70117 WP_002210401.1.70171 WP_002210401.1.70319 WP_002210401.1.70377 WP_002210401.1.70417 WP_002210401.1.70726 WP_002210401.1.7083 WP_002210401.1.7169 WP_002210401.1.72280 WP_002210401.1.72440 WP_002210401.1.72486 WP_002210401.1.7402 WP_002210401.1.74310 WP_002210401.1.74577 WP_002210401.1.74738 WP_002210401.1.75173 WP_002210401.1.7518 WP_002210401.1.75337 WP_002210401.1.75407 WP_002210401.1.75636 WP_002210401.1.75821 WP_002210401.1.76670 WP_002210401.1.77387 WP_002210401.1.77429 WP_002210401.1.78004 WP_002210401.1.7841 WP_002210401.1.78556 WP_002210401.1.79515 WP_002210401.1.79550 WP_002210401.1.79609 WP_002210401.1.79981 WP_002210401.1.8009 WP_002210401.1.80331 WP_002210401.1.81848 WP_002210401.1.81877 WP_002210401.1.8210 WP_002210401.1.82133 WP_002210401.1.82151 WP_002210401.1.82270 WP_002210401.1.8303 WP_002210401.1.83039 WP_002210401.1.83265 WP_002210401.1.8420 WP_002210401.1.84703 WP_002210401.1.84720 WP_002210401.1.85269 WP_002210401.1.85270 WP_002210401.1.8559 WP_002210401.1.85802 WP_002210401.1.86034 WP_002210401.1.86413 WP_002210401.1.87107 WP_002210401.1.87418 WP_002210401.1.8762 WP_002210401.1.87853 WP_002210401.1.87988 WP_002210401.1.88362 WP_002210401.1.88472 WP_002210401.1.89359 WP_002210401.1.8964 WP_002210401.1.90176 WP_002210401.1.9051 WP_002210401.1.90624 WP_002210401.1.91373 WP_002210401.1.91844 WP_002210401.1.92030 WP_002210401.1.92331 WP_002210401.1.92604 WP_002210401.1.927 WP_002210401.1.9311 WP_002210401.1.9320 WP_002210401.1.93623 WP_002210401.1.93928 WP_002210401.1.93933 WP_002210401.1.94052 WP_002210401.1.94201 WP_002210401.1.94545 WP_002210401.1.94683 WP_002210401.1.95746 WP_002210401.1.95981 WP_002210401.1.97245 WP_002210401.1.97375 WP_002210401.1.97448 WP_002210401.1.97791 WP_002210401.1.97864 WP_002210401.1.97872 WP_002210401.1.97894 WP_002210401.1.99109 WP_002210401.1.99383 WP_002210401.1.9941 WP_002210401.1.99416 WP_002210401.1.99788 WP_002210401.1.99882 WP_002210401.1.99990 YP_002345661.1.25044 gi|170022814|ref|YP_001719319.1| gi|162419521|ref|YP_001605642.1| gi|384416347|ref|YP_005625709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]