SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564911254|ref|YP_008877812.1| from Pandoraea sp. RB-44

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564911254|ref|YP_008877812.1|
Domain Number 1 Region: 437-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.67e-17
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564911254|ref|YP_008877812.1|
Sequence length 582
Comment SulP family inorganic anion transporter [Pandoraea sp. RB-44]
Sequence
MIALREAYRAGLLRPQQWLPNIVAGLVVGVVALPLAMAFAIASGAKPEQGLYTAIVAGLV
VSCTGGSRVQIAGPTGAFIVILSGITARYGIDGLQLATLMAGIMLWVMGKARLGGVIRFI
PAPVIVGFTTGIGVIIWIGQWPDFFGLPRITGAHFHEKFWHTLQALPGLHLATTAIALLT
LLAVVFTPRIPHLRRVPGPLVGLVLATSLQSLFRFDGVATIGSTFGGIAQGLPAFSLPAI
TLSRVLELIGPAFTIAMLGAIESLLSAVVADGMTGQRHNANQELQGQGLANILSPLFGGF
AATGAIARTATNIRNGGTSPLAGIVHAATLAMIVVFLAPLATRIPLASLAAILFIVAYNM
SEMRHFVRMARQAPKADVAILLVTFLLTVFADLVVAVNIGVILATLQFLRRMSSSVEVTQ
QSGDEISGELGAQARLKLPPSVLVFAIDGPFFFGAVENFERALVQTHSDPRVLLIRLRRV
PFIDMTGLQVLDEVIGKLHKRGVVVLVSEANDRVRGKLRKAGILATLGEPNYVSTFADAI
ARCDAIAGTSESASQAHQVELRDGGARPVRRDGDGAHGGETP
Download sequence
Identical sequences V5PQB9 V5UA56
gi|564911254|ref|YP_008877812.1| gi|560143069|ref|YP_008836060.1| WP_023595451.1.101101 WP_023595451.1.32553 WP_023595451.1.53847 WP_023595451.1.86046 WP_023595451.1.87644 WP_023595451.1.99751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]