SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858177|ref|YP_460379.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858177|ref|YP_460379.1|
Domain Number 1 Region: 47-315
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 6.87e-86
Family Folylpolyglutamate synthetase 0.00000475
Further Details:      
 
Domain Number 2 Region: 317-448
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.14e-30
Family Folylpolyglutamate synthetase, C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85858177|ref|YP_460379.1|
Sequence length 465
Comment folylpolyglutamate synthase / dihydrofolate synthase [Syntrophus aciditrophicus SB]
Sequence
MDGIDYGISGSRPEGSAKNIVCEVIINCTMENVQKEDPQRLLDLNCNIIRLGLDPIRHLL
ERMENPQLKYPAVLIGGTNGKGSTAAILSCILKESGYKVGLYTSPHLTSICERIRINGSL
ISEERMQDCFGMIQSSLEEPLTYFEVLTASAYLYFYQEKVDIAVLEVGMGGRLDATNVVT
PLVSVISNVHLEHQEYLGRHLRDIAAEKAGIIKENSVCVTAVTQKAVLDLLSETCRQKEA
TLYRLGKDIRVRVKGDGTFSYQGIAIKLDDLKCTLSGAHQIKNAALALAAAEVVTTKGIR
VNRQAMLSGVACASWDGRLEILQNTPTVLVDGAHNPAAANVLCQALRNRNADDHRLLIFG
ALGDKNYRLMLKKLLPFFDHVIFTKPKTERAVDVADLIRAARHYDRSAEAIEDSCEALQR
ALCLTGKNDMICITGSLYLVGEIKKRYAENLHAACKHGISPAVAS
Download sequence
Identical sequences Q2LQC5
gi|85858177|ref|YP_460379.1| 56780.SYN_01606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]