SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858519|ref|YP_460721.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858519|ref|YP_460721.1|
Domain Number 1 Region: 220-559
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.66e-103
Family beta-Lactamase/D-ala carboxypeptidase 0.0000308
Further Details:      
 
Domain Number 2 Region: 52-204
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.62e-38
Family Penicillin binding protein dimerisation domain 0.001
Further Details:      
 
Domain Number 3 Region: 611-663
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000536
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85858519|ref|YP_460721.1|
Sequence length 667
Comment division specific D,D-transpeptidase / cell division protein [Syntrophus aciditrophicus SB]
Sequence
MSTESKKWLKFRLMTLLVFFVILFVALFSRALHLQILSGETLKILAEKQHTKTLLLPPER
GIIFDRNGEKIAASLQVDSVCADPSKMARPADAAERITSLLNIDRQVVMKKLLHSKNFCW
IARRIPPELAQKVEEAKIEGVFLVKEPKRFYPNGDLAGQLVGLVGLDSVGLEGLEIKYDQ
YLKGTPEKLIWTRDAKGRILYHRAEKASVSSDESINMILTIDSRIQYLVESQLKAAVQEK
GAKGGLAIVMDPKTGEILALANSPSFDPNVLLSVSSNNKKNKVITDCFDPGSTFKPFLVA
AALEEGTVRENDRFYCENGSYTIANRVIHEANRKRHGALTVHDILKYSSNIGSVKIAEKL
GKEKFYEYIRAFGFGAKTGIDLPGEIPGLLRPVDNWTRVDAATIAFGQGVSVTAIQMITA
LSTIANQGTMMKPYVVKALVDKKGQIVHNYSPTAVRQVISPDTARRLTAIMTDVVGQEDG
TGKNARIENVSVAGKTGTAQKFDFSRGVYSSERVKTSFMGFFPAEDPQIAMLVILDEPQK
DRWGGVASAPVFKAIGEQILMCFKTHIRPNPLPGMEQEKNINNSDISLSLVSSSRIINAD
AAASLEADESLIPDFLGLSIRDVLRTARKRGIEVRIEGNGWAVKQHPVPGTPIAHSTHCS
VIFDHGN
Download sequence
Identical sequences Q2LR46
56780.SYN_01739 gi|85858519|ref|YP_460721.1| WP_011416587.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]