SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858520|ref|YP_460722.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858520|ref|YP_460722.1|
Domain Number 1 Region: 101-333
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 4.32e-70
Family MurCDEF 0.0001
Further Details:      
 
Domain Number 2 Region: 338-508
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 5.8e-46
Family MurCDEF C-terminal domain 0.0000408
Further Details:      
 
Domain Number 3 Region: 12-98
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 5.1e-21
Family MurE/MurF N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85858520|ref|YP_460722.1|
Sequence length 509
Comment UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Syntrophus aciditrophicus SB]
Sequence
MNLSILLKGINILGISGPSGSEVNVSSVCYNSRQCTPDSLFVAIRGLKSDGHEYIDDAVR
CGAKVIVCEKEVTMPPEITVVRVENGRRTLGLLARNFYADPSRCLVAVAVMGTNGKTTVT
YILESIFQAAGFSCGVLGTVNYRYPGLVMEAPNTTPESLDLQRIIREMVDHGVTHLVAEV
SSHAVDLRRIDDCDFDLGIFTNLTQDHLDYHKTMENYFQAKKRFFSEVLPGGRKQHRYAM
AVNADDPWGKRLIRETGEISRPLTFGIEEKADIRASSFDLSLDGIRAEIVVGSMSFDVDT
ALIGKFNLYNVLAAVSASVALRVPIEAIRRGVRAMNAVPGRLEKVSGSTQPDVFVDYAHT
DDALRRVLQSLSPFKRGRIITVFGCGGDRDRGKRPLMGKVATNYSDLTILTSDNPRSEDP
LSIIRDIEVGINSQSIPEGSSEDLSRGMTGRGYVVIPDRREAIGAAIRSARPSDIVLIAG
KGHEDYQIIGEKRLFFDDRAVAKEFLQNT
Download sequence
Identical sequences Q2LR45
gi|85858520|ref|YP_460722.1| 56780.SYN_01740 WP_011416588.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]