SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858522|ref|YP_460724.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858522|ref|YP_460724.1|
Domain Number 1 Region: 117-328
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.27e-54
Family MurCDEF 0.0000159
Further Details:      
 
Domain Number 2 Region: 330-467
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 2.62e-32
Family MurCDEF C-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 10-113
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 7.06e-21
Family MurE/MurF N-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85858522|ref|YP_460724.1|
Sequence length 475
Comment UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase [Syntrophus aciditrophicus SB]
Sequence
MDHNSTPQFSVDELLEAVGGTLLQGSTDSIIRGVSTDTRQLVAGNLYIPLKGANFDGHDF
LDVAVKKGAGGVLVDVHHAFILETGSKKTDGCLKILVDDTLKALGDLARFWRRAVGRPVI
AITGSSGKTTTKEMTAAILEQTFSVLKTEGNLNNLIGLPLTLLRMHRGHDLALVELGTNA
RGEIKRLTEIAEPDIGLVTNIGPAHLEGLKTLEIIREEKGDLYGTMPKSGLAVFNADDEA
MAPLRRSWQGKMLTYGITSRADMTASDIAKWGESGQSFTLNAGSESTVVHLSAFGMHNIY
NALAAAALSRAAGIGINEISQGLRNFHPVAARFEVHFLPNGAFLVDDTYNANPASVREAL
KTIQTLKGNHRSVVVLADMLELGDQAERLHETVGSEAAATDVDRLFLKGSLSRSTAAGAI
KGGMTEERILFFEDPEEILDDVLSFVEAGDWILVKGSRLMKMEEIVKKILDRTPA
Download sequence
Identical sequences Q2LR43
gi|85858522|ref|YP_460724.1| 56780.SYN_01742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]