SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858527|ref|YP_460729.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858527|ref|YP_460729.1|
Domain Number 1 Region: 108-323
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.01e-66
Family MurCDEF 0.0000132
Further Details:      
 
Domain Number 2 Region: 325-469
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 9.29e-48
Family MurCDEF C-terminal domain 0.0000457
Further Details:      
 
Domain Number 3 Region: 23-109
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 9.03e-30
Family MurCD N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85858527|ref|YP_460729.1|
Sequence length 480
Comment UDP-N-acetylmuramate--alanine ligase [Syntrophus aciditrophicus SB]
Sequence
MRGMPLNSMKLFRITDVMRRKVRHIHFVGIGGIGMSGIAEVLLNLGYTVSGSDLRTSDTT
EHLSSLGATVFQGHKASNLTDVDVVVTSTAVRKDNPEVLEAHRRSVPVIPRAEMLAELLK
MKVSIAVSGSHGKTTTTSMIATVMASGGLDPTMVIGGKLGSIGSNARMGHGEFIVAEADE
SDGSFLKLSPSLAVITNIDREHLDFYRGIEDIKDAFLQFANIVPFYGSAVLCLDDPHIKT
ILSDIKRKTITYGMEPAADYRAQELRFNGAVTEYELYYRTECLGSVTLSVPGMFNVYNSL
ATVAVARELDMTFPDIQQGLKSYVGVGRRLEVKGKIAGVTVVDDYGHHPTEISATLAAAR
QVWKNRMIVVFQPHRYTRTQALFREFLGAFTEADLLIVTDIYPASEDPIEGVTAEALCDG
IRSLTRREVRYIPNFSDITDYLMTVVQPGDTVITQGAGSVNSVGVSLLSRLKEVEDSRAA
Download sequence
Identical sequences Q2LR47
56780.SYN_01747 gi|85858527|ref|YP_460729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]