SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858561|ref|YP_460763.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858561|ref|YP_460763.1|
Domain Number 1 Region: 50-122
Classification Level Classification E-value
Superfamily CPE0013-like 1.28e-21
Family CPE0013-like 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|85858561|ref|YP_460763.1|
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.0118
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85858561|ref|YP_460763.1|
Sequence length 125
Comment zinc finger protein [Syntrophus aciditrophicus SB]
Sequence
MIKKELTCVICPNGCPLEVTLEEGPTPVIKEVTGHTCKKGPAWVEQELINPMRTIASSIM
VEGGDFPLVSVRTDCAIPLASIPDVMKAIKSTWVKAPVNIGDILIPKPADTSCNIIATRN
VRTAS
Download sequence
Identical sequences A0A1V4Y5X5 Q2LR87
gi|85858561|ref|YP_460763.1| WP_011416629.1.90099 56780.SYN_02448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]