SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858811|ref|YP_461013.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858811|ref|YP_461013.1|
Domain Number 1 Region: 201-226,275-456
Classification Level Classification E-value
Superfamily TPR-like 8.8e-17
Family Tetratricopeptide repeat (TPR) 0.0087
Further Details:      
 
Domain Number 2 Region: 383-455,508-552,652-769
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000601
Family Tetratricopeptide repeat (TPR) 0.0087
Further Details:      
 
Weak hits

Sequence:  gi|85858811|ref|YP_461013.1|
Domain Number - Region: 47-98
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.00248
Family Sporulation related repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85858811|ref|YP_461013.1|
Sequence length 836
Comment hypothetical protein SYN_01464 [Syntrophus aciditrophicus SB]
Sequence
MKLPFGFSNKNRRFLIVAILCSMGWVLWPHLTCHGETNRQDIHARRVSSYQNVDGAKQEV
NLLKSRGYNAYLEKVLIPDKGVWYRVFIMKGPPASRSRVSVERKKKKPVKVRPSTNDPDS
RVKMIHRPARKQVPDFSDQGIRDSSLQRQTILQKNVIPDTDNENEAHLPKRKTGRESDVK
NSLDSPSPRVFETANIHFDACRYERAAAILSSIVSKKHNDDALLENSLRLLADCYFFLGK
GKDGSFNLKAVDAYKHILRRYPDLRSRNDLVNFRLAECLEQAGNYEEAYAAYEDVIRKYP
TSRYKQDVLYKMGEILYRTGRFTHAIEKLRNYLAGYPDGPYASRSSFLLGYCFQQTGRQT
DGALWYRNALNKWDNFEELPADVLYDLGLTLFSWQDYSRAASLFATYLNLYPEGGSKKSA
MFYLGRSFYTLNRFASALKVFSLLLENYPESGEAYESILFMANIGVMEPTMNFNVCMTGW
DYYRNPVGTYDWMRRKFPGGRLEEWLLYQKGYALWKAGRCKEAFDLYCHLLDSYTHGDFK
DKSRGYLFLNARRLIEEAYGRGDDLAVADIYYKIHNKISLSAETRDLFSRAGVSLRKLGF
LSDASSVWNSLRQHGLNASGAAVLELMVVEDPGIRKGNDVPEEKWNALMKQFTENDGILK
ETAIKNLADYFYLKGRYDRAVSLYKILLEGKDNPDLLTIKGNYAHALKSNNDCASAIKIY
QKIIHEYRDSPQNYEEELITEAYAGLVDCYFENTDYQRGIAASQQAVPRMKNQQKQMWTL
FRTGQSYRKMDDMTMMEKTFSELKEKGDETFWPKVVDYWVADQAWSENNITYMSSN
Download sequence
Identical sequences Q2LRY1
gi|85858811|ref|YP_461013.1| 56780.SYN_01464 WP_011416878.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]