SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85858826|ref|YP_461028.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858826|ref|YP_461028.1|
Domain Number 1 Region: 486-675
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.51e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000389
Further Details:      
 
Domain Number 2 Region: 553-577,678-728
Classification Level Classification E-value
Superfamily TPR-like 0.0000804
Family Tetratricopeptide repeat (TPR) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85858826|ref|YP_461028.1|
Sequence length 749
Comment adenylate cyclase [Syntrophus aciditrophicus SB]
Sequence
MSDRWKALFTVSPIKISLFVILLSLTLFFMDVRFLRFMELKALDLRMLSRGAVPSCGKVV
IAVIDEKSLSELGRWPWPRTTIARLVDALRGYGAKAIGFDIVFAESENNAGLKDLERIKR
ELDQAGVNALKLNEIFSGKKNPDDPDAQLAASIRRAQNVTLGYFFHTSSKDVSHLSEREI
AAKAENISSSRYSMVKSQGMPDEAAFVHAYGVASNLPELSEAAENSGYFNAFPDIDGSIR
WSPLLIKFQDNYYSSLALSLLLQYLDWPMLSVNMAEFGVESIRIDDLRIPTDESGRLLIN
YLGPAKTFPHYSIGDIISGRLAPELFKDKIVIVGATATGIYDLRVTPFGAVYPGVEIHAT
VIDNILRRNFLVQSGWTSFLDACFIILLGLLMGTVIPRLKALQGVLVGLIILETFIGANV
VIFTRYKIWFNLVYPVMTILLVYLGITVYRYVTEEREKKKVRGAFQRYLNESVVNEILKD
PAKLKLGGDKKNLTVLFSDIRGFTTISEVLPPEALVRLLNEYLTAMTEIVFKYDGLLDKY
IGDAVMAVFGAPLEQPDHALRACNTALDMMNRLKELQKKWEADGWPLVDIGIGVNSGDMV
AGNMGSEMRFDYTVMGDSVNLGSRLEGINKEYGTNIVISQFTHEAVRDVLCCRELDSVRV
KGKKQPIKIYELLGRREDENSWGELIRRFHMALEHYKAARWDEAVAAFQSVLAIRPDDFP
SLLYIQRCETLRVCPPEAVWDGVFTMTSK
Download sequence
Identical sequences Q2LS04
gi|85858826|ref|YP_461028.1| 56780.SYN_01481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]