SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85860348|ref|YP_462550.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85860348|ref|YP_462550.1|
Domain Number 1 Region: 91-336
Classification Level Classification E-value
Superfamily TPR-like 4.04e-19
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  gi|85860348|ref|YP_462550.1|
Domain Number - Region: 448-580
Classification Level Classification E-value
Superfamily Autotransporter 0.0034
Family Autotransporter 0.028
Further Details:      
 
Domain Number - Region: 630-693
Classification Level Classification E-value
Superfamily OMPA-like 0.0576
Family Outer membrane protein 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85860348|ref|YP_462550.1|
Sequence length 703
Comment hypothetical protein SYN_00855 [Syntrophus aciditrophicus SB]
Sequence
MKRKLFILLLAVFLAAPAFGAGDLEMFNKRLAEAGNEQEKADIQKEIGDYHAGISAFDKA
ADAYIKALPHLRGRLSENDRLRIAIHMSWGGRLTESEMEIRSILQGNPENTRARIQLARV
LLWSGNPDQALAEAETVLEKLPEERDALLVKADALRSRGETDRAIAIYGSLLEQSENFDI
RIGLCHAYLKQGNVKEAHSCSALLQPAYPYQEQELAGLRGGLEKAAAQGKRYTLKAEGDA
LAARQQFTDAAGKYEEVLALPPRFPTDEWLRMATVMSWGGRHKAAKRELEAILAQEPSHF
HARLQLARVLTWMGEFDAAIQMTETLLASQPDDRNVFALLLVKANATRLRGFHRDADRLY
STLLSQAEDFDARLGLTYSYLAGGYRVKTDESLAQLKPRYPYEEKELDQLRAARDRAFRP
RIYGGVTFYDDDDDNEVTTFSTGAQVWLGNWKTNLDYRHASADDPDRTEDSDALQLSTYS
RMPWYGGLGGGIGISGGSIMTWKALADFDVFYGSVGFLAAREAYAYTAELLDNEIRATIL
AISIIQRPTDRIALRGSYSYRDFSDDNTSNDIQAGVSYLFFRKPAMAVGYRFRYLDYERQ
SRGGYFDPDNFLANSAFVNLSFETDRFYGYIEPYVGYQNYERYDDSHSEIFYGSTGSLGY
RVNKWLAVEGNAEWGNYGGSNLSSGSDDGWYYSQLGLQFILTF
Download sequence
Identical sequences Q2LWC3
gi|85860348|ref|YP_462550.1| WP_011418401.1.90099 56780.SYN_00855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]