SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|17619|estExt_Genewise1.C_30566 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|17619|estExt_Genewise1.C_30566
Domain Number 1 Region: 46-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.09e-89
Family GABA-aminotransferase-like 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|17619|estExt_Genewise1.C_30566
Sequence length 520
Sequence
MWIYLQTFISYALLIVLGHLRDFFGKMLFPASYAHLRPSNGYAPLFSDFDSFYTRRLKLR
IEDCFSRPITAVAARTAVILNRTPTNFFADFTFTGETTQALNVSSYNYLGFAQSRGPCAD
QAEEIVHKLGVTTSGGRNDVGTSDLHIQAERLVAKFVGTEDSMIVSMGFATNSTTLPALM
CKGCLIISDELNHSSIRFGARLSGAMVRMYKHNDMEDLENLLRECISQGQPRTHRPWKKI
LLIVEGLYSMEGTMVDLPRILELKQTYKFYLYVDEAHSIGALGPRGRGVCDYFGVDPKSV
DILMGTFTKSFGAAGGYIAGSHELISALRLHSHAQNYAEAMSPPVVAQICVSMGSIMGLE
ATTIVPSLSSLPAHVMDGREGQDRLRRLAFNCQYLSGGLRKLGFIVYGHQDSPIVPMLIF
APGKMGLFSRLMLERYKIIVVVVAYPATPIVSSRIRYCLSAAHTKADLDRILRATDEIGG
ILGLKLSPHGPRMKIDDVINEGVEMVRQTEQELTLALTAE
Download sequence
Identical sequences jgi|Sporo1|17619|estExt_Genewise1.C_30566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]