SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|18563|estExt_Genewise1.C_60090 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|18563|estExt_Genewise1.C_60090
Domain Number 1 Region: 118-357
Classification Level Classification E-value
Superfamily Radical SAM enzymes 2.88e-29
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.057
Further Details:      
 
Domain Number 2 Region: 354-547
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000317
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|18563|estExt_Genewise1.C_60090
Sequence length 561
Sequence
MVSTVPSLSAAESTIVVCSDIVANLLQAHERGQTVNLNALKTSIAKKHGSNVVPRLVDII
SAVPQESRDLLLPLLRAKPVRTASGIAVVAVMSKPHRCPHIAMTGNICVYCPGGPDSDFE
YSTQSYTGYEPTSMRAIRARYDPYEQSKGRVEQLRGLGHSVDKVEFIIMGGTFMSLSEQY
RSEFVTGLHNSLSGYTGKDVDEAVKYAEMAKTKCIGITIETRPDYCLKPHLSSMLRYGCT
RLEIGVQSVYEDVARDTNRGHTVQATCEAFQMAKDAGFKVVSHMMPDLPNVGVERDMAQF
HEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKNYSPNALVDIVARILALVPPWTR
VYRVQRDIPMPLVSSGVENGNLRELSLARMRDFGLTCRDVRSREVGLHEIHNRVRPDELE
LIRRDYVANGGWETFLSYEDPERDILVGLLRLRKCTKEGTFREELVGKDGQLNSSMVREL
HVYGTAVPLHSRNPTLFQHQGIGTLLMEEAERIAREEHGSQKLAVISGIGVRNYYARLGY
KLDGPYMSKMLEDRMEEDELF
Download sequence
Identical sequences jgi|Sporo1|18563|estExt_Genewise1.C_60090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]