SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|20509|estExt_Genewise1Plus.C_11257 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|20509|estExt_Genewise1Plus.C_11257
Domain Number 1 Region: 100-519
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.06e-100
Family Pyridoxal-dependent decarboxylase 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|20509|estExt_Genewise1Plus.C_11257
Sequence length 559
Sequence
MSSRPSVTLVTALTRQLATVENAKTFIFWYLVQRQVFRCIRHLRARGLVTTAHEFYLEIV
KRGFAIMMLIPSVKAKVKGELDQVTTELEAKLAPKDGPSKNYLALPETGLNSTQVSAALD
EMSSIPNTKWDTGRVSGAVYHGGKDVGDIWREAFGKFEVSNPLHADVFPGVRKMDSEIVS
MCLSLFNSPLPTSAVDENGGAGTTTSGGTESILMACKAYRDRAKAEYGITEPEMIVPISA
HAAFDKAAKYFGIKIHHIPVDVESRKVDIRRVKRAINRNTIMLVGSAPNFPDGAIDDITA
LSKLALKHRLGLHVDCCLGSFLVPFMERAGFPMDPFDFRVPGVTSISCDTHKYGFAAKGT
SVIMYRSKAIRKYQYSVITTWPGGVYASPTIAGSRPGALLAAAWASLLYLGIDGYTASCR
EIVGAAQTIARSIRKDFPELYVLGTPLVSVVAFGSRTEGQGNGKGSVPVYEVGDRMDKLG
WHLNALQNPPAIHIACTKLTVPAVDDLLRDLRIAVDEVKAMDKAGGGSMVTLYGLGSGSP
IGPGLVEEMASRYMDVLYA
Download sequence
Identical sequences jgi|Sporo1|20509|estExt_Genewise1Plus.C_11257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]