SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|21332|estExt_Genewise1Plus.C_30477 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|21332|estExt_Genewise1Plus.C_30477
Domain Number 1 Region: 157-466,520-582
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.5e-69
Family GABA-aminotransferase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|21332|estExt_Genewise1Plus.C_30477
Sequence length 588
Sequence
MTSVVRTGASASPSPSPISASLPELLNALNSSLSSLAALSNRVPGSAIAWRYLKASHQDD
PLRTVLEILLVFFIVRTYLMARTKGESSGKNFVKFSEKEIDELVSEWQPEPLLPPNQEIP
LHPPILVGATGPRPRVIFPQPGQDPHDPLEPLSLDQQGKQVTNLASSNFAGLAGNDRIKE
KAVGCLRRYGVGSCGPAGFYGTFDVHLELERDIAQFLRVPAAINYAQGFSAISSVIPAFC
KRGDIVVADRGCNFAIQKGIQISRVSVKWYDHGDYESLERILEGIKKEDKKYRRNPTASR
RFIVTEGIFENDGSMVDLPKVMELKHKYKYRLILDEGWSIGAVGKTGRGVTEVFDIPAAG
VDIITGTMQNAFSSSGGFCAGSVEVVAHQRINSPTYVFSAALPPLLAVSASEAISLLSTP
LSSTDPAHPLSTLPTNIRALRQVLDQIPTIEIPSAEMSPLIHVTIKPSVLEKPASEGGRP
GGGRQRSHSHVSHPQPSHGGKTQQQVAEASMQAESSRQEQERLLQEIVDLCGENGVLLTT
TKRTWAQEMTEIKPSIRICVSAALTKKEMEKAATVIKNAVNKVLGKKK
Download sequence
Identical sequences jgi|Sporo1|21332|estExt_Genewise1Plus.C_30477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]