SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|21428|estExt_Genewise1Plus.C_30658 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|21428|estExt_Genewise1Plus.C_30658
Domain Number 1 Region: 51-507
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.37e-121
Family Pyridoxal-dependent decarboxylase 0.0000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|21428|estExt_Genewise1Plus.C_30658
Sequence length 550
Sequence
MSLSRHVNPDRIIEASREHAKKTGRTSIHDLMERSEPGIMSRNVTHQDDGTEPIPKYKFP
SHGVPAEEAYETVRTELSLDGNPTLNLASFVHTSMHELGTKLMIENMAKNLIDSDEYPAT
TLLHSRCVSMLAQLWHADDRAESATGTATTGSSEAIALGGLAMKKRWQAKMKAAGKSIHE
PGPNIIMGANAQVALEKFARYFDVEARMVPVDASTNYCMDPKRAIEMVDENTIGVFVILG
STYTGHYENVQEMADLLDEYEKKTGIDIPIHVDGASGALYAPFATPSLVWDFRIKRVVSI
NTSGHKWGKAYVGVGWVLFRDKKHLPKELIFELHYLGSVEYSYSINFSRPAAPILAQYFN
FLYLGFDKYRQISLHDAKNSRLFARALENSKYYTVVSDIHKPKNAGLVDKAKASIGLVDD
IEHYVPALPVVAFQFSPEFKKEYPRIKQASIQHGLRQSNWIVPNYELPPNAQDEEVLRVV
MREKFNEDMVERLVVDIMQVTESLMKEHENDVKNPGENGVAGGDKKHKNAERRAANHGEG
TRPVGHDSVC
Download sequence
Identical sequences jgi|Sporo1|21428|estExt_Genewise1Plus.C_30658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]