SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|24766|fgenesh1_pg.C_scaffold_1000652 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|24766|fgenesh1_pg.C_scaffold_1000652
Domain Number 1 Region: 17-572
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.03e-60
Family Pyridoxal-dependent decarboxylase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|24766|fgenesh1_pg.C_scaffold_1000652
Sequence length 577
Sequence
MTLPSVMYPAEEAASYDVDTFQRELQRVNAFVKERARTLPELPTTSTKEIIEDALQTLPR
DLPASGIGLSATTDCLLETISPALAPAQSGPRCFGLIIGGVTPASQLAEAIVTSFDPCVQ
VAWPVRLPFATEATASVAIEALTLEYLLTLLSLPKAVFTQNTLTTGATASNFLGLALGRN
FAVSSVKSRQGIEDWSCSEDGFGGVEVDVFVVDAHASIRKAASMAGIGRRNVHEVGSRQL
EEAGYWCCFDLEELEKRLRANFEHGRGSLVCSSFGEVNSGAICSDTPAVRALCDKYSAWL
HCDAAFAAFAVLHPDFEQYTPHLSLADSITTDGHKWLNVPYDCGLFFSRKRPILSTSSNV
TSLFELTGPGSVVAAYLSTSSSIPVSEFPFPLLDASRQIPSPLFMNIENSRRLSVVSTFS
SMPSNLARAYIFDTSRALPLYASLLSLGFEGYKSLIRRNVSFARKVDAFLRSHPSYDVLT
PTPSTSPNDPFAYRVLNIVLFAPSSAAPARYRLPGPNSEDPASVFLAALNESKEMFVTGT
SWRGRKAVRIAVSNWMTDESRDLEIVKRVLEKVMGVE
Download sequence
Identical sequences jgi|Sporo1|24766|fgenesh1_pg.C_scaffold_1000652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]