SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|25983|fgenesh1_pg.C_scaffold_3000053 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|25983|fgenesh1_pg.C_scaffold_3000053
Domain Number 1 Region: 169-319
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000724
Family N-acetyl transferase, NAT 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Sporo1|25983|fgenesh1_pg.C_scaffold_3000053
Domain Number - Region: 370-479
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0013
Family N-acetyl transferase, NAT 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|25983|fgenesh1_pg.C_scaffold_3000053
Sequence length 502
Sequence
MRGSYRGSTSFVMVGEEEVEVGREGRSREPAIVDRRRCFCIAAFEAAFGPAYRPFSGDCL
RKPVLSLRREGTDGEEAPLRDLQIRWSAFETTSVTKVRTSLTSTVCEESCDPNPIISSRT
SAGRAPRGFRLDSTFFSSTRLNLTRRDTNLATYLITGTALSTFIHYTYMLPTPSFSTDRL
VFRSPEPADLAAPNGFLFKLYSTESVQHGLTATPARPTSREGVEKFFTQLSVKEGAAIDC
IFSLKCTEGQEAGEEPVGWITLDKIDTLHRKTTFGLAIAEKHGGGAFAWNEKAVRCYKSV
GFVIEARRQQDLWQNGTFIEGLEIGILASDWRERRDKLATREKKPALHSTSDSQVPAERP
SALSRPLPSVPSFSTSRLSFRSHEPADYARPDGFLYNLVTDENVLYNLAPAVVIPPASQE
VEKWFTTARESASIHTIFSLKRNPDSKEEAEPIGWMTLDKIAGLHRKATFGVVVAPKHQV
NRDLLLFSEFAGGSDLSRRSTG
Download sequence
Identical sequences jgi|Sporo1|25983|fgenesh1_pg.C_scaffold_3000053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]