SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|33130|estExt_fgenesh1_pg.C_60161 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|33130|estExt_fgenesh1_pg.C_60161
Domain Number 1 Region: 3-136,172-358
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.43e-75
Family N-acetyl transferase, NAT 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|33130|estExt_fgenesh1_pg.C_60161
Sequence length 423
Sequence
MATEDWSCSGLEALRLRLCRSKEETTALAQDEAQLVERFSPSFVYPIFGEEETIFGYQGL
EIDFRFASGSLNQYLSITHTAKFPSTTSVQADDPEKILYEFIPPSYSKNLGDFQVRVEKD
AKEFVPVGDKIGSYRIARHQAEGKGKGKADSASSLPRRQWEPAEQGDRVGDDEAVYEAFW
SNWDTPGFKEFHRRAQIFVLLYIEGAQYIDEEDARWEFVTLFERRKGRDSTHSYHFVGYV
SFYSFFCWPDTKRLRLAQFVLLPPYHGKGHGSALYNLCYENILKRTDISELTVEDPSETF
EDMRDKCDLYTLISGGQLKGLNCVPTIDRTLTEKVRKEYKLADRQFYRLVEMILLLQLSP
TSSPNSSTDPRARGFRLTVKKRLYLFNKEQLLQIEDAQERKDKLQETFESVVEDYRRLTE
KFT
Download sequence
Identical sequences jgi|Sporo1|33130|estExt_fgenesh1_pg.C_60161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]