SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|33334|estExt_fgenesh1_pg.C_70163 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|33334|estExt_fgenesh1_pg.C_70163
Domain Number 1 Region: 274-509
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000545
Family Tropomyosin 0.00065
Further Details:      
 
Domain Number 2 Region: 484-692
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000144
Family Tropomyosin 0.0012
Further Details:      
 
Weak hits

Sequence:  jgi|Sporo1|33334|estExt_fgenesh1_pg.C_70163
Domain Number - Region: 1072-1279
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00068
Family HBL-like 0.033
Further Details:      
 
Domain Number - Region: 667-793
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00547
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number - Region: 1325-1397
Classification Level Classification E-value
Superfamily Tropomyosin 0.0252
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number - Region: 843-913
Classification Level Classification E-value
Superfamily Tropomyosin 0.0752
Family Tropomyosin 0.0064
Further Details:      
 
Domain Number - Region: 117-225
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|33334|estExt_fgenesh1_pg.C_70163
Sequence length 1998
Sequence
MNNTPCTQPEFCLAGTDSARASNSECYPHTSPHLLSCTMDDSALQERAAKAARAKEKVGG
NHRRTQTLDEATHANRLHQLRKFQAAKTLKAQQSLRPSSPLPPLHAPAPASDTTSIPGSP
ASTRGDYPHVPLPSHVPPPPRSTHSPALFDSTIRPQHFEPLPAGVPPPPRRMAVATPPPF
TPTSTTAIDYSVPSPSSSRNAFRPKTPASPSHSNSTGVVVSPPLPSSPNDVQAGLLQSQQ
QTISLLIADKATLSTRVQELQHRIDDGFASQTDDDALQRAGELEEELRRIEEERERDAER
IANLERGVDIARHALKDAHARIAEQEDELQDLSSRLSEVQSSTASSDHEERIRLQSDHID
SLEFELSKVRNSLDELSSEKQSIESQLAEARQAAETARTEFTTLSTAHSAATGELEMLRY
RSEQVENGEAPDAQEEIAELTQFVSSLQADWKAASDQAEEAERKVKALQGQLDEVEKTAK
LAATRRDELQQENDELMKSLEEVRGKVVTLTNEKSEWVDERGTLKNKLREAEQEVEKIRT
EASGQSVEESEKAAKELEEVKRELDQVTSELEDATRRLEEAEKEVYEQRSAVDEKDEAIK
TLEEQLQESRSAFEERDAVVRDLEEDAEVLRASFRQKDDTFRSLEEEASSLRQTVSEFEQ
TVSTLESTLASTRQKHESANESTRQLEADVSTHLSTIESLTSQVETHASIVQGLESDVSS
HLSTIRTLESSLTALENTLASAQQELASSREDAEAIAAVRQGLERDIVAHLATITSLEST
LSSLTDSSSSSSTRAESLAKAVAELEAVKASQDSELATLRSSVAGLEQSTEEVTHERDQL
QFKAASLETDLSTARSTLSTAQSELESARQAVSSAEAQLVEAQAEVQTIKTEVAAAQEEL
LSTRMELEQAEQAHVELQTSSSTQSTDYEALLARITALETELATAQEETAKASSEATNHL
SELDALRSQHQEATSSTTASAEKIGQLEQTLREQEGQLAAVEEELSQLKEVEYSLRVELE
AAEAAKRTAESTSPKSSSSVSDLERDLSVFKDILAASESRATALQQSLTAAEKDLDEREL
EISRLEGEAATRETKERELEFSLETVTSKAAQSASRVGDLEETLDEARRSHSETLDSVKG
ELSNLKTELVKLQGEHDQALAARATAESDCTKAKAKADILDGQLRLANADLAPAQGRVSM
LEQQLATSQSEVARLTTAHETLQATNVTLTSAVEELRTNLATISDTQSTGSDQVAALRSS
LAQAQESEHSLRQQLESLRSELEDVERSRLEVEEELARCRGEVEETSTTLSAAMTELDAT
KEECTDLEKAVEDAREEARSAVAAKVLIEQEKQQLSSELEGLTARLSDSSNRVTEVEEQI
STLKRTLKDKESALDALETDRSHEAAAASERARESTVKLKDAVRQASKTERELKAIMEQD
RASEVEMLRNAVSRLEEEISRHRSGAVPTSVSSPATRDTSSLEEELERNVNEVEALRRAL
EEQQDQAAEANNALEELRTLYSQAQEELEDLRSGSSLRPSDRSSPTATTAPSALGDADAL
QLELSSARAQIRSLEDECFHSEQTRVKMLKANGDLKSQIESLQDALDKERLKANSTPSSP
LPPPTALTPRVPSLPSSAQSTPTRGPPGRGHAHRRTASTLPSVTEIDDVAPGTFPPAPPP
PSSLQAPFVPSSSTPTTGHRSASSRHVRQASLSLLKQRMEDELGTDAFDDAGRRAPNGAN
SSTGSRTKRVPLSNDLLCPRSPSPVSRFSLRQHLHDLTESVRSLQKRFCENLASLEYRAS
LALFAQANFVLGEERMEYNSLFTSAERRRGWKKQIARSEESIKGACKAQTPGRDRYGEDR
ASTLREGEDEREGGSDDAKSDPGRLFGEAGKGTRQGSADEEKSLAAGSDEDRAQGFAQGS
VSKAKFRGSGSRSRTRRSVNNSPMFEGRSEIRMERESKGVKLNEICRIRKLAIVSVECGQ
FYDLPQRFEVVRKDSFKL
Download sequence
Identical sequences jgi|Sporo1|33334|estExt_fgenesh1_pg.C_70163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]