SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|33458|estExt_fgenesh1_pg.C_80030 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|33458|estExt_fgenesh1_pg.C_80030
Domain Number 1 Region: 1139-1218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000631
Family N-acetyl transferase, NAT 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|33458|estExt_fgenesh1_pg.C_80030
Sequence length 1676
Sequence
MGPQSDGSSREMSTASDGDMFLSRGAGSRATGNGFPLATGLVGHSKGSYTGKLEHMERYY
TAAGGGTRVGGLTGLGIRVTNHQSKSFLSLGDDDEAESREEISYRGTSSSLRFGLITTSD
NREDRSDAVSIASTCPDLDLTPIVDAFPSPPTPASMPSPPVHSASHPQLVPFDVHRQLRH
RPSISTIASELTLASTASTSSSLETPSPQTPSVSEMTPIAIPRPNAAAIRRVRSFAKPVL
PTIGTTPPTPTSPSLPVPSLPAPSLSRSEASPTSQPLIQTPYGFFSPPYGRIPRNPEPPS
APPPDRPLPSLPSLPEQAPRDSRLVAFPSSGVPGSQKKLPLPPPSQLSRRQSCTPIPEAP
AVPSKDDLDARSSRIERPRTVSVESDSSTPTIKSPSTSSINPPSPLDDSLSTLPSVVAVP
CRQPRTRVESESSVASLDISHISKQLDQLVCDNISPDPSTSSSDKLQGTEEKEKGEVAEL
TEKEQERERVRRLISRVSSVIEMRKLSTASSSTTSSIVEASPNNRERNGYKAYKLTRKPS
LSPSTSFSSFSTPGHSTFKENFQGGGGGTPTTSEDRSRTSSYNDSDSESSASEEMFDLSF
DSQLLSPSSIGNTSTSSSSSSTSSGEYHSNRFSSPLGGSGSRRYVRRSHVPPRWAGRRRS
SETTIEEEEVLDDDRLKRSATRRADQFFSQRDTEHYDVVLPEEAAEEIHESPSTEVPSRR
KTLRNVASNETFQSRLRSPGTKTLRTVSSVPTLRNPSLPDSPLSRPSTYSSSPLSSEFGS
PKTTGLRPLITSSPPHTRRSFISTPSASPSSSRIPLSGFSRNSPSPQFSDPFSSCPSPSL
NYRAPSATPRKSSLPIPSSFGQTAPASTGLRRPSAPAALAGPHRRKSSLANLSYHHTTSI
PPPSSPSPLSRSLHDPRNSRMAQESLLYLGTAQSVAEPEQSLLRIGIDPKGSPSSRVAQR
MAALYEHSDSTPLIRLLGSHLPHSLPTFSPLLTPGNPLKVYTTFKSTAEPAISDPSSTEQ
PWIVLIDSGNQFRFYCNLTTREPSPEKLQEAEDLIESVIREVMDRASREGREVVRIGAVP
DRWTGAVSRVTGVECISASRVWCDPSYYRSEATQAPLLIPDHDKDSTTQRIEAPEGFDEL
AAHVTTHRDGSLGTLYVNPSYRRLGLARLVLQHRLSKMREPGREGSDEEDRKRLGFCYVH
RENEASRAVMKSLGWRESEGNVAWDIVDVKAWDAKRKSKPTAIISFSSLSGSSSQEHRKQ
TFQAANPCLGEPEGYVHRDAGFAPRRTQARAPAVLNPRGVENLRVRFKMPDSSSMSSDPQ
ILYHVLSIAGSSDDRALQYQIVERLWQLSLDKESRSGIPRPTYYKHPFYFYQIMPGVEGG
KDWYFRQQGSSFKAYNPKLDYSASYDPSGRAASLGHRSASIHRVDRKAWMEARGESETPS
RMDALAGYQHVLGGLEEQNKAKLTNRAQFSRLWAKFEALTPEDHVRKNLIVREMIELLGK
TSPQDYHVEHRTSPDGKNWTQLVQYSDLYFHLVRDHEILQYNEKTRHVESFSAKSTPEEV
TRTKGIIAEKYAIYKRLCATSGGNTEDSKALLFFIVYTAESLDLETRRATFEHITEFGDK
EFFRYVRGCSTYFRIADEDRKIVQRFDAAAHANMGHRARQIYELDPPSEYSSTRRF
Download sequence
Identical sequences jgi|Sporo1|33458|estExt_fgenesh1_pg.C_80030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]