SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0C02376g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0C02376g
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily ITPase-like 9.16e-52
Family ITPase (Ham1) 0.00000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0C02376g
Sequence length 195
Comment similar to uniprot|P47119 Saccharomyces cerevisiae YJR069C HAM1 Protein of unknown function that is involved in DNA repair mutant is sensitive to the base analog 6-N- hydroxylaminopurine while gene disruption does not increase the rate of spontaneous mutagenesis [Kluyveromyces thermotolerans] Complete CDS. KLTH0C02376g
Sequence
MVQKIVFITGNENKLKEVKMLLATGESEEPIFELTSANIDLPEMQSGSLEEIAKIKVSEA
LKHIPKGQAVFVEDTALCFDEYNGLPGAYIKWFMKSMGPEKIVRMLDGFENKGAEAITTV
AYGDSEGKIHIFQGRTKGKIVEPRGPPTFGWDCLFEPTEGTGSTYAEMEKKDKNKISQRS
KAFAQLKKYLYTQAA
Download sequence
Identical sequences C5DDN2
gnl|GLV|KLTH0C02376g XP_002552331.1.30775 559295.KLTH0C02376g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]