SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0G10978g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0G10978g
Domain Number 1 Region: 52-164
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 7.32e-36
Family Frataxin-like 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0G10978g
Sequence length 170
Comment similar to uniprot|Q07540 Saccharomyces cerevisiae YDL120W YFH1 Yeast Frataxin Homologue mitochondrial protein that regulates mitochondrial iron accumulation [Kluyveromyces thermotolerans] Complete CDS. KLTH0G10978g
Sequence
MLKRSIITFGTAVARRPVLRPYAACVRAFSRLQVIPTARGFASGPGSTDGHEIPKEVLEL
SADAYHISSDAFLDSLQEQLEELSDAYPDLLPDVELTQGVMTLEVPAVGTYVINKQPPNK
QIWLSSPVSGPNRFDFYKNRWISLRDGQDLLSLLNIELSDVLPKPVTIEA
Download sequence
Identical sequences C5DMR2
XP_002555510.1.30775 gnl|GLV|KLTH0G10978g 559295.KLTH0G10978g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]