SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0B06270g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0B06270g
Domain Number 1 Region: 8-57,105-521
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.21e-57
Family AAT-like 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0B06270g
Sequence length 525
Comment similar to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9 Aromatic aminotransferase catalyzes the first step of tryptophan phenylalanine and tyrosine catabolism [Kluyveromyces thermotolerans] Complete CDS. KLTH0B06270g
Sequence
MQALEEHYKPFLSSRVEARKFSPFWSQNLPEGLKPHPKPIDLGPGLPHEGFFPIESMHLN
VVEEPFQHTSAGTKSHKLHKPAPEGSKHFEERAFVTEKLSSDSAVDVWRYEPNSPEVIPL
SQGLQYTETAGMKQLLDFCRGFVSYAHPPAYNEWDVTLANGSSDATFKIIETLCDSSVTV
LVEEFTFSPTLAIITAAGGTTVPLKLDITADPDVQGINVEYLTDLLDNWSQGPNAHLSKP
KLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDPYGYLRYPFYDRKNPDYNPY
ALHEYTAKDYCEKVLSKSFITMDTSGRVLRCETFSKVFCPGLRLSFIAGNKYLIKKIVDF
AEVSSRAPSGLSQLIVNNVIQKWAKSYSSPQEAWLVWVMKVAGHYTHRRNMFVQALEATE
AFSEGLFSLAQTSAGMFLAVEINFDHFAKSLSITERSKAMQRLSSISIEEGVGIIQGINM
AADRKYSLARSFFLRLTFAFAADVEELQEAADRLGKSVKRLAAEL
Download sequence
Identical sequences C5DCW2
XP_002552061.1.30775 gnl|GLV|KLTH0B06270g 559295.KLTH0B06270g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]