SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0B09306g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0B09306g
Domain Number 1 Region: 123-454,493-545
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.91e-66
Family GABA-aminotransferase-like 0.0000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0B09306g
Sequence length 552
Comment similar to uniprot|P25045 YMR296C Saccharomyces cerevisiae LCB1 Component of serine palmitoyltransferase responsible along with Lcb2p for the first committed step in sphingolipid synthesis [Kluyveromyces thermotolerans] Complete CDS. KLTH0B09306g
Sequence
MRQPPEVLPSSIPVPEAVLRSSSYVWYYCQRAAHAIPGMRYVVSYVRKSHQDDPYRTLFE
LFLIIYGIIYFFRKPRKQGEQAAPKLSEREVEALLDEWEPEPIAQQNIKLEWRAKSTPVL
MGNSSAPTRVNLTRDEGRESYSDVLNCASTSFLQISSDPEFVKAAKDTIHQYGVGACGPA
GFYGNQDVHSELEYNLARFFGTERAVLYGQDFCIAASVIPAFTKRGDVIVADDRVNVALQ
NALQLSRSTVYYYNHNDMEALEELLEQLQERELNEKLPSLPRKFIVTEGLFQNLGDIPDL
PRLVELKRKYKYRLLVDETFSLGVLGANGRGIAEYYNMKRDASVDITIGSLAVALGSSGG
FVLGDNVMSMHQRIGSHAYTFSAALPAFAVTTASRVLDHLEHDNSAVQKLRSLSQLMHQL
FIDDSELSPYIEVTSSKESSILHFRLTDEYRSRVFHTTEESLFQELSAMHAKNLSEKYIE
GCEREEKLLQRIVDMALKEHKVLLTRNTFVLKHETLPVTPSLKLCCSAKMTEDELRSACE
SVKSAVLACTSE
Download sequence
Identical sequences C5DD92
gnl|GLV|KLTH0B09306g 559295.KLTH0B09306g XP_002552191.1.30775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]