SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0E04070g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0E04070g
Domain Number 1 Region: 350-408,558-604
Classification Level Classification E-value
Superfamily TPR-like 0.000000869
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0E04070g
Sequence length 719
Comment similar to uniprot|Q08754 Saccharomyces cerevisiae YOR299W BUD7 Protein involved in bud-site selection diploid mutants display an axial-like budding pattern [Kluyveromyces thermotolerans] Complete CDS. KLTH0E04070g
Sequence
MCPRAAAAPPPLSPAALAAPRTNIEPPRRVREDEIGSAIEERRAKLPQFQDLGPPDLVSI
VKYTPSGSANAHNNKRSSMQLEPSTSSPAAGSAVAAAGDLHVNDKHKGEVGTFLYCVGAD
TSDPTSIAVFLKGMADAIAEKPQVWFGRHKPYRVARITFATWNAFRQCDVEVVVHIPGAV
QSYFLDTRGEVLAVAPDERELVWAETFASGVVRAIAMMADNREDGEVNNVVETRILNPLL
SGEIGDVADHFIDVFPLLYARGVALGAPCDVACASRTNNYLCETLLHVTRLTRNFRRCRA
MLEGMLGDHPEAVVLLARVLFAADLEVDAVRLIHDDLAAHGGVVTAHRSELLCVQAAFLL
DAKRDYAAAQRLAQAAVDCAPSEFRPWHLLVQSYVGLNDIENALLALNGCPVAPHRDRYI
FKRVISVAQDSANLHLPLPMDVVLDEVTGLNSRDIINEHKSVSPALLNLPAATLKANART
RYHLLTEIARKTGWESLLRYRSKLFVMEEEYQVAATPPAEEGDPLKPDGIRTKRLCERWL
DNLFMVLYEDLKAYTLWQAEQLHFEAQNTHYSKTTTEWELLGLCALRLGHREEAAAAFEA
GLQHRFSAESCRKLLQIYLHERSRLKKDSDLSSSQVTAAVLDYDNKIIDLCVKICCWNHR
WYSEFSILLLDSLSVVVDDMGITKLSNEISSRFPETVVQLANDNLLAFYADYTDGGYDK
Download sequence
Identical sequences C5DHG1
gnl|GLV|KLTH0E04070g XP_002553659.1.30775 559295.KLTH0E04070g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]