SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0E05236g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0E05236g
Domain Number 1 Region: 7-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.53e-112
Family IF2B-like 0.000000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0E05236g
Sequence length 417
Comment highly similar to uniprot|Q06489 Saccharomyces cerevisiae YPR118W Methylthioribose-1-phosphate isomerase catalyzes the isomerization of 5-methylthioribose-1- phosphate to 5-methylthioribulose-1-phosphate in the methionine salvage pathway [Kluyveromyces thermotolerans] Complete CDS. KLTH0E05236g
Sequence
MSLEAIQFDRSHRDDISVRVLDQLLLPYTTKYVPIYTIDDGYTVINTMQVRGAPAIAIVG
ALAVLMEIQLLQNDGFARTQTFYDISSFELTRSALSQRLDFLLSSRPTAVNLSNALREIR
VLLAQSAGLAAFGNGVYDFVCRLIDEDLTNNVKMGDNGAAFLLDALQQEGFDEDFAVLTI
CNTGSLATSGYGTALGVVRSLWNDSLAKSQAPGDGSAKKRKLNQGRAKMVQVYPLETRPY
NQGARLTAYELVHDQIPATLIPDSSIAYRIATSPVPIKAAFVGADRIVRNGDTANKIGTY
QLALVCKHFGIKFFVTAPKTTIDSKTETGAGIVVEERKPNEFKHVSGTLIDSQTGLPCVD
NQDKPVSASVGVAPSEIDVWNPAFDITPHELIDGIVTEDGVFTKSASGSFDLTNLFA
Download sequence
Identical sequences C5DHL1
gnl|GLV|KLTH0E05236g 559295.KLTH0E05236g XP_002553709.1.30775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]