SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0E10934g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0E10934g
Domain Number 1 Region: 267-568
Classification Level Classification E-value
Superfamily TPR-like 5.18e-99
Family Tetratricopeptide repeat (TPR) 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0E10934g
Sequence length 568
Comment similar to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5 Essential for import of proteins with SKL- like import signal into peroxisomal matrix 69-kDa protein containing tetratricopeptide repeat (TPR) [Kluyveromyces thermotolerans] Complete CDS. KLTH0E10934g
Sequence
MSADCSVGSNPLASLNKHAQQDRSLHHGGGLRLNNEAAQRFKSQDSVVSDASRARMEAFM
DQEHMDHPMMLKGPRPMLSRPLQESSQQARESWGKQFSSSPALSMNQSPELHSPTSQVPS
IAYQKGLPAGNTEGSQVMRARVVGPRYGPGLASGMFNPMSHQTAQQPVYRHSSPQSHMSM
NQESWDEQFKELEKEVSEKLALHEEEVKPQAAAAEQDVVEDQYQAEFQEVWDNLQEESQI
PDAGGDVETDWQREYQQYISGRPSDTTQYRFETENQYLHNSNAYEIGCILMENGAKLSEA
ALAFEAAVQEDPSHVDAWLKLGMVQTQNEMEYNGIGALEECLRLDPRNLDGMVTLAISYI
NEGYDVSAFKMLNKWLETKYPDMVAPNEALEKSTDRYSMNQAITLRFLQVVNKLPQVDAS
LQLGLGILFYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKAL
QLKPTFVRARCNLAVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKRA
FIGMERRDLLEEVRPNMDLAPFRNEFNF
Download sequence
Identical sequences C5DIA3
559295.KLTH0E10934g XP_002553951.1.30775 gnl|GLV|KLTH0E10934g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]