SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0E14080g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0E14080g
Domain Number 1 Region: 55-517
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.68e-106
Family Pyridoxal-dependent decarboxylase 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0E14080g
Sequence length 567
Comment similar to uniprot|Q04792 Saccharomyces cerevisiae YMR250W GAD1 Glutamate decarboxylase converts glutamate into gamma-aminobutyric acid (GABA) during glutamate catabolism involved in response to oxidative stress [Kluyveromyces thermotolerans] Complete CDS. KLTH0E14080g
Sequence
MLHKHNPKHVHERSEHFGRSGDSLSNSYKLLSDDLQKIALEGDSELQTKHRSLGSSYTIP
QTGLPSEAAYELVHNELTLDGNPHLNLASFVSTTSTQTARRLIMENIEKNLADNDEYPQM
IELTQRCISMLAQLWKCGKDTKPLGCATTGSSEAIMLGGLAMKRQWEKKMKEAGKSTEKP
NIIMSSAAQVALEKFARYFDVECRLVPVSHESDHHLDAAKLWDYVDENTIGCYVILGTTY
TGHLENVEEVADVLSQIEKQNPGWGNTTIPIHVDGASGGFVVPFAFSEKQMAAFKLARWG
FNHPRVVSINTSGHKFGLTTPGLGWILWKDDEYLLPELRFKLTYLGGVEETFNLNFSRPG
FQVIHQYYNFLTLGEKGYKSLFDKALFTARTFSHALLESDEFKGHFEVVSSIHERIDGGE
SRLHDYMTEPESFKPGVPLVAFKLSKQFHEKYPEIPQALVSSLLRSHGWIVPNYPLPAST
DGSDKWEVLRVVFRSEMSLDLAQLLLSHILRALRKLVKCYEGVAETADVDQRRDAIYRML
LTLAEPEGAEPSEEDAKKRRKNYRGTC
Download sequence
Identical sequences C5DIP3
559295.KLTH0E14080g XP_002554091.1.30775 gnl|GLV|KLTH0E14080g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]