SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0F10846g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0F10846g
Domain Number 1 Region: 241-526,560-611
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.72e-88
Family IF2B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0F10846g
Sequence length 615
Comment similar to uniprot|P12754 Saccharomyces cerevisiae YGR083C GCD2 Delta subunit of the translation initiation factor eIF2B the guanine-nucleotide exchange factor for eIF2 activity subsequently regulated by phosphorylated eIF2 first identified as a negative regulator of GCN4 expression [Kluyveromyces thermotolerans] Complete CDS. KLTH0F10846g
Sequence
MSEQNSQAPPSSPKEVPSSGSSGSSTSATTTSSATTEGKAPLSNKELKELKKKEKAAKRS
AKKEASGISIEKQQQQAQQKREKKQVQRDQQQNGGSKKGKVAVPAPVAKRSTLYGHLETT
EERRASLLAVTSAISSSQASKITAAGLMLPSVASVLSGSHVPTNSAIAPAMSASTSQTHG
LSSAPEPSVTETAQLLASMSVDDEFSLVPGTSSVIPQSLLKTLSFPQLSSSVKELITNRD
LLHPAIAQLTSDIAGYKIVGSIPRCLAMLEAFQVAITDYKTPEGTTLCRNLTSYLSHQID
FLKKARPLSVTMGNAIRWLKQEISLIDLATPEAEAKEDLCEKIAQFAREKIELADQLIIE
NASQHISNGSTILTYGCSKVLCDFFLYNATELGKDFQVIVVDSRPLFEGRKMTDILRNHG
LKVMYVLITSLGTVFNMHIDYVFLGAHSILSNGFLYSRVGTAMLAMSAKRRNIPVLVCCE
SLKFSQRVQLDSVTSNELADPNDLVVIDSNNPVKRRSNKGFLLQQFIKEREIEIANSTQD
QKKSGKGPASSPPVSKTFEENKPILADWQTSPKLNIFNIMYDLTPPEYIKKVITEFGALP
PSSVPVILREYKGSA
Download sequence
Identical sequences C5DL85
gnl|GLV|KLTH0F10846g 559295.KLTH0F10846g XP_002554673.1.30775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]