SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0F19140g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0F19140g
Domain Number 1 Region: 635-762,795-841
Classification Level Classification E-value
Superfamily TPR-like 6.68e-17
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0F19140g
Sequence length 924
Comment similar to uniprot|P42842 Saccharomyces cerevisiae YNL313C Protein required for cell viability [Kluyveromyces thermotolerans] Complete CDS. KLTH0F19140g
Sequence
MELLELFVRFRALTTICQSKMEAVLHTALLLDKGDIIKSTPAAHSDDKTVRFVNSILKGC
QADLVSELLDPIRLLDGKSFCNGQELFEFLNAELVKHFPSKSDALLLAVALLQLFVQNNY
TGPAASSSAHTVLHESNDSDGKAHALSVCLLSVFGQPAYELCDDAIYLVMSIILLEQITE
QQSLFSGGNEGSGVVEIPASETPALVACAHWWRARALLVQLSLLPEPSGLQPIVVSSILG
SVDLVYAISKELPSHLKSSLEKQLGVIYYLENVKCSLATNTEHLCLPSLTKVQKLTGLQF
VLTGARAKRTKYQQEARSGLIILAKSSPSSTNIEDEKDSLSPESFELNSDVLLERPIFQS
IGDEPIDDQIVKRRKFDGEAGLDEEKLLPVALRQEDIPLDLRELDPNEQPALTNYDNAQL
LLRLYVIRQTSPAQNPLVEEELSAILGRVLYQSGKKNWTLFSRALWERSVVETTKAKTIE
RGLLQMQSLVEEMEIKIKTRMLPQGDVNEKVESNVRMSLIHQLPFMPRWSLDAKLAEKYM
SVGILRSAVDIYERLGMLCEAALCHAAVGDEKTAESILAKRIEDNEHDARALSILGDIRQ
DPNLWLKSWEIGKYVNAKNSLARYYYNPPSSSGLTKDYNACLKHLNESLSLYPLAFDTWY
FYGCIGLECGKTDLAAEAFTRCVSLDDTHSLSWSNLSAAYIEQGKLKEAHSCLSKAIGSD
SQNNWRIWDNFMLVSMKLNMWGDVLLACRKLVEIRKNKVGEFSIDLPVVEKLVELLVTSD
FPSNAPERLSHFQSSCMEFICDILPTVVTTNSRCWNQVARVELWRKRPWAALECYEKEYR
AMSHNPDLEFDEKVWNQTVDACDDLVAAYESLGVMEGKHGEGSLVCKDWKYKARSTIKSL
MSRGKNNWEDSDGWERLLEMRRNL
Download sequence
Identical sequences C5DJU2
XP_002555018.1.30775 gnl|GLV|KLTH0F19140g 559295.KLTH0F19140g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]