SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0G05984g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0G05984g
Domain Number 1 Region: 489-652
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000889
Family Tricorn protease N-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  gnl|GLV|KLTH0G05984g
Domain Number - Region: 1004-1152
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0458
Family WD40-repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0G05984g
Sequence length 1307
Comment similar to uniprot|Q06632 Saccharomyces cerevisiae YDR301W CFT1 Functions in cleavage of 3'-ends of pre-mRNAs prior to polyadenylation 23.5% identical to the 160-kDa subunit of mammalian cleavage and polyadenylation specificity factor (CPSF-160) Component of pre-mRNA cleavage factor II (CFII) 150-kDa protein associated with polyadenylation factor 1 (PF I) [Kluyveromyces thermotolerans] Complete CDS. KLTH0G05984g
Sequence
MNIYNEIFDATQVSHALLGHFTSEKTEQLIVAKTNILSVYTTEDGKLVLLHEFKLHGQIT
GMALVPQMEGPLDCLVVSTGKAKLSLVRFDPSMPMCLETLSLHYYEAEFTRKNLIELAKT
SKLRLDPERRCVLLFNSDVLALLPLNINEEDEDDNQEPTHQAKKRKVENGDARRLAKQSS
VLHVSDLSAELKNVVDIQFLNSFSQPTLAVLYQPRLAWSGNDKVAGKGSMRLMAITPHEK
KNTTIYQVKELPHDVHTIIPLANSCVLVGVNEIVSVDNTGAIQSTIQLNSFSPKFTGSKQ
IDNSSLEVMFTEPIVWASAMVSKDREILILMDHKADMYSITLQSEGRLLIDFTLVRLPIV
NDIFKDQNLPTCIVALSGGIRLKTCQFFIGFSSGDAVVVKSNNLRSAFESQYREAIELPN
DEDEDYDALYGDDEDLARPVNDNKATVETAVPFEIELMDSLINVGPITSICTGRVSSINA
TIEGLPNPNRNELAIVSTSGHDSGTYLNVMEPSVRPLVQQALKFTSVTKIWNLKIRKKDK
YLVTTDSGAEKSDVYEIGAKIASIKPKHFKRNVTTVEIAILGGGKRIVQVTTKAVYLFNL
GFKKLMTISFDFEVVHVSILDPFILLTNSKGEIKIYELDSKHRKKLTKVPLPEVLEEMII
TSGAILKSSICNQFMIGLENADKDQLLFTFVGADNQIIMFPKEHHDRVFQLNGVDMLSEM
LYVSTYQLPEEIVPDPSIKQVMINKLGKDKKEEFLTILTFGGEIYMYRKTGNKFFKSMQS
NDLQITGAPGNAYAKGVSAIERIAHYVKYYNGYSIILITGSTPYMIVKEDYSTPKIFKFA
NIPLVSLAPWGTDSVLCVDDIKNARIVTLDTTFSYGNRLPVKRVPIEDPLNYYGCLNNVA
YHERSGMYIVSYTKEIEYEAISEEGEKTVGSDDSVPHARGFQSGVLLLNPKSWNIIDKAD
YEKNSLINDMKTMLIQTNSRTRRKREYLVVGNTFVRDEDIGTMGSFCLYDITEVVPEPGK
PDTNYKLKQIFYEEFRGAVSSVCEISGRFLISQSQKVLVRDVQEDNSVVPVAFLDVPVFV
TDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGKSVSKFEVMSLEFLVNNGSIYFLVS
DRSNILHILKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNDEFPTLGEPPAFQAI
GAQTDGSLFNVVPLSESSYRRLYMVQQQLIEKDVHLCGLNPKMERLQNDFYQLGHLMRPM
LDFTVIKSFATLPLNKRKQIAAKAGRQADFEIWRDLINVEYSTRSLC
Download sequence
Identical sequences C5DM49
gnl|GLV|KLTH0G05984g XP_002555297.1.30775 559295.KLTH0G05984g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]