SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLTH0G18634g from Kluyveromyces thermotolerans CBS 6340

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLTH0G18634g
Domain Number 1 Region: 360-592
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.22e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 294-367
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.01e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.013
Further Details:      
 
Domain Number 3 Region: 5-79
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.0089
Further Details:      
 
Domain Number 4 Region: 209-267
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000418
Family B3/B4 domain of PheRS, PheT 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLTH0G18634g
Sequence length 593
Comment highly similar to uniprot|P15624 Saccharomyces cerevisiae YLR060W FRS1 Beta subunit of cytoplasmic phenylalanyl- tRNA synthetase, forms a tetramer with Frs2p to generate the active enzyme; evolutionarily distant from mitochondrial phenylalanyl-tRNA synthetase based on protein sequence,but substrate binding is similar and similar to gnl|GLV|YALI0E22979g-gnl|GLV|DEHA0F08404g [Kluyveromyces thermotolerans] Complete CDS. KLTH0G18634g
Sequence
MPTVSVPKKHFFELLGKNYSTQEFDELCFEFGIELDEDTTEEALKNNEEPELKIEIGANR
YDLLCTEGIAQALNEFLGKAQRPQYKLSQPTTKLFIEPSTEQIRPYAAAAILRGVTFTET
SYQSFIDLQDKLHSNLCRNRSLVAMGTHDADTIKGPFYYKALPPKDIKFIPLNQSKEFDG
AELIQFYKQPDQKNNLGRFVHIIEDSPVFPVVIDSENTICSLPPLINSEHSKISMNTKNI
FIEATATDKTKVEVVINQIVAMFSRYCAEEFTVEPVEIVSEHNHQSRTTPDFSPKSMNVS
TQYINSCLGLELSAGQICDYLKKMSLYGQPEGKDVIKVDIPITRSDILHPCDIMEDAAIG
YGYNKLPKGKKLSNANFVAAALPINKVSDIFRQASAQASWLEVLPLTLCSHDENYKFLRV
EDDGTQAVKLANPKTSEYQVVRTSLLPGILKTVRENRKHSLPIKVFEAGDVVYKNDKLER
KAYNERHWGAIYVGKNSGFEIIQGLLGKIMQTFRTQWVADYGKGSSTRGYWIEEDDSVAT
FFPGRGANVMFRSKEGEQPQKIGQLGILHPEVMKNFDLPYAASYVELNAEVFL
Download sequence
Identical sequences C5DNN8
gnl|GLV|KLTH0G18634g XP_002555836.1.30775 559295.KLTH0G18634g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]