SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|101800|estExt_fgenesh1_kg.C_2030004 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|101800|estExt_fgenesh1_kg.C_2030004
Domain Number 1 Region: 248-443
Classification Level Classification E-value
Superfamily Thiolase-like 1.21e-68
Family Thiolase-related 0.00000663
Further Details:      
 
Domain Number 2 Region: 28-287
Classification Level Classification E-value
Superfamily Thiolase-like 8.26e-67
Family Thiolase-related 0.000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|101800|estExt_fgenesh1_kg.C_2030004
Sequence length 444
Sequence
MLRRATSTCSARGFSTLSFGALPPTPNRRVVVTGLGAVTPFGVGVSRSWDALLDSQCAIR
TVDALADTDLKCTIGAAVPRGEGDGAFRTKDWVNLKNLRAQEPDFIAFTLAAADEALKDS
GWSPQSDEERERAGVAIGAGMGNIQEVMDVGQLIKDKKYRRVSPFFVTRILINLAAGHVS
IEHGLKGPNHSCVTACATGSHSIGDAANLIRHGNADVMVAGGTEATLNEISICAFMRAQA
LSTKFNDRPQEASRPFDSQRDGFVMGEGAGILVLEEYEHAKKRGAKIYAEVRGYGLSGDS
NHITAPLESGDGARRAMKSAIEQSGVALSDIGYINAHATSTPLGDRAENAAVKDLFGEHA
NHLGMSSTKGAIGHLLGAAGAIEAIFSIKALHHNVMPPTLNLTETTEEFTLNYVPNQPQE
KELRAVLTNSFGFGGTNASLLFAK
Download sequence
Identical sequences jgi|PhycaF7|101800|estExt_fgenesh1_kg.C_2030004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]