SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|103904|estExt_fgenesh1_kg.C_170272 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|103904|estExt_fgenesh1_kg.C_170272
Domain Number 1 Region: 23-152,411-534
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 4.45e-69
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00078
Further Details:      
 
Domain Number 2 Region: 219-383
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.26e-42
Family Group II chaperonin (CCT, TRIC), apical domain 0.00027
Further Details:      
 
Domain Number 3 Region: 158-225,377-412
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 7.32e-26
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|103904|estExt_fgenesh1_kg.C_170272
Sequence length 545
Sequence
MSKSMGLNVAGGLSSMLKDGHKHFEGVDEAVAKNIDAVKQLAAITRSSLGPNGMNKLVIN
HLERIFVTSDTATIVKELEVIHPAARMVVMAAKMQENDFGDGTCLVVALAGELLMEAASL
LRMGLHASEIVTGYQKAHDKCQEILQKLQSVQIKDPRDQEELQKAIKTSLASKQYGYEDL
LAKLVAEACLNVMPAAPKKPSINVDNIRVAKIMGGNLNDSTVIRGMVIQRNTEGNVKKAL
KAKVAVFGCGIEISSTEAKSTVLIKDADELMNYNKGEEKHLEEAVRAISESGATVVVSGG
SISEMALHFLEKYNLMAVKIQSKWELRRLCRAVNANALVRLGAPTPDEMGFCDSVTVKEI
GGKKVTVFQQDEEDAKISTIVLRASTDNVLNDIERAIDDGVNCVKSVCRDGRFVSGAGST
EIELSRQIKSFGEATPGLDQYAIKKFGDAIEVVPRILAENSGQMATEVISSLYAAHAAGN
VSAGVDVDNEHESHVIPDALDKGIWDHLQTKMSAIRLGADAAITVLRVDQIIMAKAAGGP
KPRGM
Download sequence
Identical sequences jgi|PhycaF7|103904|estExt_fgenesh1_kg.C_170272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]