SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|106577|estExt_fgenesh1_kg.C_420156 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|106577|estExt_fgenesh1_kg.C_420156
Domain Number 1 Region: 31-229,257-275
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.43e-44
Family Adenain-like 0.00031
Further Details:      
 
Weak hits

Sequence:  jgi|PhycaF7|106577|estExt_fgenesh1_kg.C_420156
Domain Number - Region: 229-294
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.0942
Family GroEL-like chaperone, apical domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|106577|estExt_fgenesh1_kg.C_420156
Sequence length 303
Sequence
MQTYTKSSESEDDVDGNITVLTYPLPPCTSDIVTIIRRDVSRLKPRRYLNDNIIDYYFKR
MMMDTLGGNLLVQEKVLFLSSHFYSRLRAGKGTSASERMEAGYKNVSTWLARSNVFNRSI
IFIPINKDLHWSLAVILNPGIAGSGPNNEASSCIAVLDPLGSYHRKAAIIRNLRTFLRML
WGNTQNNGEDEYAMDRVVSMNVKAPQQENSYDCGVYVLKFAEVILKNCLELDLLGQSNGV
ISKEITDNNLEALISSSAFSGEDITATRKQIREYIETDTSEYQLRKKEEKEKKVQASMKQ
QQE
Download sequence
Identical sequences jgi|PhycaF7|106577|estExt_fgenesh1_kg.C_420156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]