SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|108997|estExt_fgenesh1_kg.C_3970001 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|108997|estExt_fgenesh1_kg.C_3970001
Domain Number 1 Region: 208-399
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.43e-79
Family GroEL-like chaperone, apical domain 0.00000199
Further Details:      
 
Domain Number 2 Region: 30-157,429-547
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.37e-71
Family GroEL chaperone, ATPase domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 161-229
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 8.01e-24
Family GroEL-like chaperone, intermediate domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|108997|estExt_fgenesh1_kg.C_3970001
Sequence length 577
Sequence
MNPTLAVAVKKAARFSPAGRRMFSSGKDIRFGVEGRAAMLKGADQLANAVQVTMGPKGRN
VVIDQSYGAPKITKDGVTVARSVDFKDKFENMGAQLVRSVASSTNDAAGDGTTSATVLTR
AIFSEGCKSVAAGMNPTDLRRGIQMAVDHVVDGLQKLSMDVADKEKVAQVATISANSETE
IGNLISDAMERVGKEGVITVQDGKTLYNELEVVEGMKFDRGFISPYFVTDNKTQSCEMEN
PYILLVEKKVSSLQSIIPMLETVVKQQRPLLIIAEDVESEALAALVINKIRGGVKVCAVK
APGFGDNRKASLQDMAVLTGATVISEDLGHRLETATPEMLGSAKKVTGTKDDTLMLDGAG
SAEAVEERGNLLRASIESTTSEYEKEKLQERLAKLSGGVAVIKVGGASEVEVGEKKDRVV
DALNATRAAVAEGIVPGGGAALLWASRSLNTLYDSCANLDQKVGVEIVERACRAPATQIA
KNAGHEGAVVVGKLLENDSPELGFNAQTGEYVNLVDTGIIDPTKVVRTGLVDASSVASLM
MTAEALIADHPEEAGAAAPPMGGMGGMGGMGGMGGMM
Download sequence
Identical sequences jgi|PhycaF7|108997|estExt_fgenesh1_kg.C_3970001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]