SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|110017|estExt_fgenesh1_kg.C_82500003 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|110017|estExt_fgenesh1_kg.C_82500003
Domain Number 1 Region: 26-301
Classification Level Classification E-value
Superfamily Thiolase-like 1.35e-56
Family Thiolase-related 0.0000823
Further Details:      
 
Domain Number 2 Region: 307-442
Classification Level Classification E-value
Superfamily Thiolase-like 6.43e-27
Family Thiolase-related 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|110017|estExt_fgenesh1_kg.C_82500003
Sequence length 445
Sequence
MVFRRNLVSMGAQSSRALSTAAAKRAVVVDGVRLPFAKSGTVYKDVIAYDMMRDAFKGLI
NKTAIDPKSIDYVLAGTVIQEVGTSNIAREAALGAGVPKHVPAHTVTQACISSSQAICSG
AEKILSGHADIVLAGGVETFSDVPIRFSKPIRERLINAPKAMKKGPMGVLKLLQGLKVSD
FAPVAPAIQNFHTREIMGSSSDRLATRFGVTRQEMDQYTIDAHQKAYRAHVEGKYKGEIL
SYKGSTEENGVNPNSTLEKISTLKPAFIKPHGTHTAANSSFLTDGAAATLIMSESKALEL
GYTPKSVLKDWLFVGVDPFETLLLGPAYGIHQILTKNKLKLSDIDYFEIHEAFAGQVLAN
LNALAEPKYCKELFGIDQAVGRVPSEKLNTWGGSLALGHPFGATGSRLVNTASNKLQKEG
GKYALLAACADSGLAYVGLIENYKK
Download sequence
Identical sequences jgi|PhycaF7|110017|estExt_fgenesh1_kg.C_82500003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]