SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|112928|estExt_fgenesh1_pg.C_35770001 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|112928|estExt_fgenesh1_pg.C_35770001
Domain Number 1 Region: 423-659
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.11e-58
Family Phosphotransacetylase 0.0000103
Further Details:      
 
Domain Number 2 Region: 252-383
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000000000000129
Family DRTGG domain 0.0074
Further Details:      
 
Domain Number 3 Region: 53-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000133
Family Nitrogenase iron protein-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|112928|estExt_fgenesh1_pg.C_35770001
Sequence length 663
Sequence
MWTLRNTIRRTATAVRPQRRALTAAAIAQGKVPIDKLFVTSTEMSNKTAPVLIGLANTLE
QKFSRVGYFRPIQPSKESSMADHHVEVMREQLGLNKEVNQLYGVTSERAIESWLNGKEDD
LVEEILDRFEACREGHDFMIIEGSQISKHESAMSWKINVDIAKAIGSPVLTISDFSESAN
TNGELLEEILSRTALNEDQVTGAGLSFIGNIANRVNTKDPKGLREALRSKLAEKDLQFLG
FLPKDDFIASKRLNEVTHQLGATQLFGTKAIPNNVVVTSAVVATSALKDLFAHLKNYKDG
ALVITSADRSDVMLGLMASRLPGILPNVSAIVLTNGSYPHSNTQEILQGVEALDKTGLSI
PIFSVPEDTFTTADKFTKVTTDILPTSQLKIDRSKQLFDEFVGKEGLIGELDEGMVVNRS
PKQFQHFLFSKSRAVKRHIVLTEGEDIRVLQAADQVLRQKLAKVTILGNPNDIERHAKSL
NLDLSGANIVRTADSDLLDHYVDRYFEKRKHKGVTRESARDAVLEETCFGTMMVELGDAD
GMVSGACHTTANTIRPALQLIKTAPNRPIVSSIFFMCLEDGVRIYGDCAVNTDPSAQDLA
QIAVTSAESAEAFGLIPKVALLSYATGDSNSGPIIDKVREATKIAQELRPDLDIYGPIHS
FFA
Download sequence
Identical sequences jgi|PhycaF7|112928|estExt_fgenesh1_pg.C_35770001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]