SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|113382|estExt_fgenesh1_pg.C_40337 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|113382|estExt_fgenesh1_pg.C_40337
Domain Number 1 Region: 434-760
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.1e-94
Family Pyruvate phosphate dikinase, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 3-357
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.71e-93
Family Pyruvate phosphate dikinase, N-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 323-436
Classification Level Classification E-value
Superfamily Phosphohistidine domain 3.53e-32
Family N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system 0.097
Further Details:      
 
Domain Number 4 Region: 965-1060
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.07e-24
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0005
Further Details:      
 
Domain Number 5 Region: 811-895
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 9.94e-16
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00043
Further Details:      
 
Domain Number 6 Region: 896-962
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000000589
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|113382|estExt_fgenesh1_pg.C_40337
Sequence length 1630
Sequence
MIGNLAGLGVSVPGGYATTAEAFKDFIAHNDLSKRIFDKLATLDVEDVNALTAAGKEIRS
WVIDAPLQPQLDQDIRTAYAKLSADNGGGDVAVAVRSSATAEDLPDASFAGQQETFLNVT
GADDVVHKVKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGVQLMVRSGVGSSGVLFTLDT
ESGFRDVVFVTSSFGLGEMVVQGAVNPDEYYVYKPTLQAGKPAILRRSLGSKAIRMVYSD
VPGERVKIEDTPAELRNTFSISDEDVQELSKQALVIEKHYGRPMDIEWAKDGVSGKLFIV
QARPETVKSRSHATQIERFALTEKGGNVLAEGRAVGAKIGSGVARVVKTLDDMNRVQPGD
VLIADMTDPDWEPVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGSGNATKVIEDGQLV
TVSCAEGDTGFIYEGKLGFERTTTDLGNMPPAPLKIMMNVANPERAFDFGQLPNAGIGLA
RLEMIIASHIGIHPNALLEYDRQDAATKKKIDEKIAGYGDPVSFYVDRLAEGIATLTASV
APNPVIVRLSDFKSNEYANLIGGSNYEPHEENPMIGFRGASRYVDPSFSAAFALECKAVL
RVRNEMGLDNLWVMIPFVRTLEEGRKVIEVLEQNGLKQGENGLKIIMMCEVPSNALLADE
FLEIFDGFSIGSNDLTQLSLGLDRDSSIVAHLFDERNPAVKKLLSMAIKAARAKGKYVGI
CGQGPSDHPDLAEWLMQEGIESVSLNPDTVVDTCPASAGLAVSGVLARHAYLAPVPQQQR
NFRMIAAAPPSPAATPWFHSLDWERLLETYGVPLLAAIVVLLVGLWVARRLSNAMPRATA
RMGVDPMLGSFLRNVVYAASIVIVVVLAIGTLGVQITPLLAVLGTAGLAVGLALKDSLSN
IASGVMLVTLRPFRVGDVVTVAGQTGTVREVRIFQTVLTGADNQHTTIPNTLITAAPIIN
LTAEPTRRVELVIGIGYEDNIQLARDTALALMKADPRVLQTPAPDVVVYELGAHAINLGI
RCYVKSADWFGTKVTLLEQLKLGYDKAGINIPYPQQDMHLYLHGKDGGVVEADALRRIIP
IRFGNVQVAHPHLTEQVCGSQIGRLRRIVHRPLQRGQRRQAHANAVTTGYCDHRLHDLAQ
EAQPVLQRTAIAIGTLVGLRVDELVDQVAIGAMQFDAVEARLQRIAGGLRVIGDDARNLV
FAQRTRHRMLDHLADAGFGTCPCRVDEHFHAIGQQCRGRHRRCAIGLQGHMRDAADVPQL
RVDAATGGVHRIGHLPPALYLFGAVDARRPGIALALRADLGAFTDNQAGTGTLRVARMAR
HEGSSTHGVDLLQAGFDLYRAMRHAVIAGAHHVFPVLQLQPAHDEVTARHVLVVVGEHGI
ERCTCSGTDNRHRLRSEFLGDHHAETRRHFLHHLRQQLAGLLRRHAQGQVAAGHHAPGQF
GRQVAHHVGGEAAGQVVAGLAGVIARRVATQREHLQAGLAGAEPGQVKALAAGHVGHRAH
HDGGRHRQLDEQGRKAKCPATAPEVAAASLCQRVEAPLPGVLSMLHSAACADLVSAACTA
PWMRLETELGSAFTANSSGVPTRLAMRAVRVGASSSATARCRSDQSRASWAMSRGSRMGS
FMAPILAPGS
Download sequence
Identical sequences jgi|PhycaF7|113382|estExt_fgenesh1_pg.C_40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]