SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|113500|estExt_fgenesh1_pg.C_50117 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|113500|estExt_fgenesh1_pg.C_50117
Domain Number 1 Region: 448-702
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.72e-50
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000297
Further Details:      
 
Domain Number 2 Region: 237-435
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.93e-31
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|113500|estExt_fgenesh1_pg.C_50117
Sequence length 730
Sequence
MENISAPNADMALYLNIYTSPGRLNYSEDKIVHPAYKLELRRLQNYSVTPLAPENKNVHL
YLAKMKGSDLHIVTDRFQRIFYDAYPGPARSLVDALNALELNLSNPLVMKTSLPTKNYHV
YLNILPQAIVDPQYQEGVIRILAYRYAERLEQLGVSTVELKIIARFNSEAPAIPVRLVEE
NPTGYVVRVQAYVEAAGHDEPIFTSIGDETYGELNGMPVTASYPVVSPFDKSLHQWHGRE
IIIIANGITFKVGPFGTREDTLFDLASMLARSKGIPRFFFFFSASAGARIGMADSIKALY
KVCWKDETNPTKGFEYLYLTPEDYWISSADCAVNAELLVTCTGEERYVLNDIVGREIDLG
VECLCGRGTIAEWLQMAIILTGYQELNKFMGTEVYTSNDQLGGVKIMHTNGATHLTAKNH
LPGIYAILERLSFVPAVRRGRLPIRDLTDVDEIERTVNLCPKDKSTQYDPCALLAGKVGE
ATAIPASQENLMQQAGQVWFPDSAHKTATAIKDFKGEDLPLFILANWHGFSGGQRAMFDE
VLKFGAAIVDGLVNYEQPVFVYISPFAERRGGTWAVVDPIINEGIMEMYADLQGRGGVLE
PARLSQETASQLTSRLVELSAKEKETEGAKITAEIKAREETLLSSYVEVSTAFDDLYDIL
GRMEAVGCIRQVVLWSNSHKFFYWCLKRQLAELLLCREVVAASAGGPRATTFVGSEKILK
GWFTEAINSG
Download sequence
Identical sequences jgi|PhycaF7|113500|estExt_fgenesh1_pg.C_50117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]