SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|113902|estExt_fgenesh1_pg.C_60343 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|113902|estExt_fgenesh1_pg.C_60343
Domain Number 1 Region: 250-495
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 4.32e-70
Family HlyD-like secretion proteins 0.00000258
Further Details:      
 
Domain Number 2 Region: 915-1116
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.14e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.000000886
Further Details:      
 
Domain Number 3 Region: 1451-1647
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.96e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000126
Further Details:      
 
Domain Number 4 Region: 657-751
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.75e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000252
Further Details:      
 
Domain Number 5 Region: 1182-1283
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.77e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00039
Further Details:      
 
Domain Number 6 Region: 1284-1334,1428-1477
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.16e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00021
Further Details:      
 
Domain Number 7 Region: 801-890
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 5.49e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00012
Further Details:      
 
Domain Number 8 Region: 754-801,893-949
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.59e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00069
Further Details:      
 
Domain Number 9 Region: 1335-1426
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000392
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00077
Further Details:      
 
Domain Number 10 Region: 30-98
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000016
Family Tetracyclin repressor-like, N-terminal domain 0.0098
Further Details:      
 
Domain Number 11 Region: 98-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000001
Family Tetracyclin repressor-like, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|113902|estExt_fgenesh1_pg.C_60343
Sequence length 1676
Sequence
MVLAPASALPTGSAKLHHVNPAYLPVALDARDERVFDAVRELLAQQGMQMSMDAVAQHAG
CSKQTLYSRYGSKQELLRRVMQRHVGHATGAMVRALRTDDLRASLLQFATDFLEHFNQPH
VGQACRLIAADASQFPEEARTLYRHGAGALTLHLAEWIETVCMRGQLRHDDPHFMAELLL
SMIAGQDFDKQRFHTSHRDDAQLLLRWAEFSVDSFLRAFAPQPSPKPEQQTPPPPEVGVI
DAKPQTLPLQRELVGRLSPFRSADVRARVPGVLLKRVYQEGSQVKQGQPLFLIDPAPLRA
SLNASEAQLASARATYANAKVAADRARSLAPQQFVSKSDLDNAESAERTALAAVKQAEAA
VTSSRISLGYTEVTAPISGVANKQQVTEGALVGQGDVTLLTTVDQLDPLYVNFSLSVDEL
TQLRAQQAKGALALSGDGKATVNVKLADGTTYSEPGTLDFSSTTVDPATGAVSLRALLPN
PQQILLPGAFVSFQANLGERNNAYLVPQQALLRDTTGGYVMVVGADGKVIRKNVKTDGAQ
NGNWLVSDGLAAGDKVIVAGVQKVKEGAPAVAKPWTPGQDANGKPAAGGAAPAGAAPAAG
KAPADAAKPEQADAAKPEQADAAKPEQADAAKPAATDSNKHGVIAILNLGVESYPNIAPP
QVTVSATYPGASADTTEKSVTQVIEQQLTGIDHLLYFSSSSASNGRAQITLTFETGTDPD
IAQVQVQNKVSLATPRLPSEVTQQGVVVAKANAGFLMVVALQSDTAAINRDALNDIVGSR
VLDQVSRIPGVGSTQQFGSEYAMNIWLNPEKMQGYGLSASQVLAAVRAQNVQFAAGALGS
DPSPEGQHFTATVSAEGRFSSPQEFENIILRANADGSRVLLKDIARVAFGANNYGFDTQY
NGKPTGAFAIQLLPGANALNVADAVRAKMDELQPSFPAGVTWFSPYDSTTFVKISIQEVV
KTLFEAVFLVFLVMLIFLQNFRATLIPTLVIPVALLGTFLGMWMIGFTINQLTLFAMVLA
IGIVVDDAIVVIENVERIMTEEGLAPKPATQKAMTQITGAVVAITVVLAAVFIPSALQGG
AAGEIYKQFALTIAISMAFSAFLALGFTPALCATFLKPTHNDNPNIIYRTFNKYYDKISH
TYVGHITSAVRHAPRWMILFVVLTALCGFLFTRMPGSFLPEEDQGYALAIVQLPPGSTKG
QTNEVFAQMRGILEKQDGYEGMLQVAGFSFVGSGENVGMGFIRLKPWEERKFTAPEFIQN
MNGAFYGIKEAQIFVVNLPTVQGLGQFGGFDMWLQDRSGAGYEQLTQARNILLGQAAQKP
DHLVGVRPNGLENAPQLQLHVDRVQAQSMGMSVSDVYSTIQLMLAPVYVNDFFYEGRIKR
VTMQADGPYRTGQESLKSFYSPSSLTTNADGTNAMIPLNTVVKSEWVSAPPSLSRYNGYS
AINIVGSQAPGTSSGEAMQTMEAIVNDDLPAGFGYDWSGMSYQEILAGNAATLLLVLSIV
VVFLCLAALYESWSIPVAVLLVVPLGVLGALGLSMLRGLPNDLFFKIGLITVIGLAAKNA
ILIVEFAVEQRAAGKTLRDATIEAARLRFRPILMTSFAFIMGVIPMAISTGAGANSRHAI
GTGVIGGMLFATLLGLLMIPVFFVVVRRMLGDKLDEPSKEFMERQRDADAAHRPDR
Download sequence
Identical sequences jgi|PhycaF7|113902|estExt_fgenesh1_pg.C_60343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]